CAZyme Information: C2_05050C_A-T-p1

Basic Information

• Species: Candida albicans
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Candida; Candida albicans
• CAZyme ID: C2_05050C_A-T-p1
• CAZy Family: GT91
• CAZyme Description: Glucose N-acetyltransferase 1 [Source:UniProtKB/Swiss-Prot;Acc:Q59ZI3]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
462	Ca22chr2A_C_albicans_SC5314|CGC6	55311.96	7.4075

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CalbicansSC5314	6468	237561	256	6212

• Gene Location: location=Ca22chr2A_C_albicans_SC5314:1045870-1047258(-)

Full Sequence      

MTSKSSSWKALLKNWEFKVAAFIGIYFLISHVVLETTDVVNEKGLKSHLKVLPEEVIDYY
GKQPFSNVDKYAYMQYATNYDYLNLAIINFIHLRKANTKIPNLVIIYDEVLHYYASDKWS
ELYQVANQYKITLKAAPLIKASYQDDSNWAASFTKFHIFNQVEYDRIVFFDSDSMLVDIP
NEIDFDNMESRFNHIDELFKIPQELSFASPQAYWLNNVVEGKSPRPRKNVEIPNKKRYSL
RMKKLVNDLSIYQDFNLLPSLIYENHYFDNANHFFANHIMVITPSKNTFQELMRYIHNPW
WWSITNRGSLRKPNDYDMEILNKYLNNELQRKRINVGILPHRVYGVLTGEFGEEWHERFV
VEPQYLPFINKKSNKGWSPLEFFKKIKVVHFSDSPIPKPWEEENNEEHYNIKKIYCDKGD
MEKFHKDYPVYKPRLTDDCDSVSIWNWFREQFYKERSGYWFA

Enzyme Prediction     

No EC number prediction in C2_05050C_A-T-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133064	GT8_GNT1	7.70e-117	71	452	1	278	GNT1 is a fungal enzyme that belongs to the GT 8 family. N-acetylglucosaminyltransferase is a fungal enzyme that catalyzes the addition of N-acetyl-D-glucosamine to mannotetraose side chains by an alpha 1-2 linkage during the synthesis of mannan. The N-acetyl-D-glucosamine moiety in mannan plays a role in the attachment of mannan to asparagine residues in proteins. The mannotetraose and its N-acetyl-D-glucosamine derivative side chains of mannan are the principle immunochemical determinants on the cell surface. N-acetylglucosaminyltransferase is a member of glycosyltransferase family 8, which are, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed, retaining glycosyltransferases.
132996	Glyco_transf_8	1.43e-23	71	400	1	244	Members of glycosyltransferase family 8 (GT-8) are involved in lipopolysaccharide biosynthesis and glycogen synthesis. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. GT-8 comprises enzymes with a number of known activities: lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, glycogenin glucosyltransferase, and N-acetylglucosaminyltransferase. GT-8 enzymes contains a conserved DXD motif which is essential in the coordination of a catalytic divalent cation, most commonly Mn2+.
133018	GT8_Glycogenin	1.03e-11	71	302	1	195	Glycogenin belongs the GT 8 family and initiates the biosynthesis of glycogen. Glycogenin initiates the biosynthesis of glycogen by incorporating glucose residues through a self-glucosylation reaction at a Tyr residue, and then acts as substrate for chain elongation by glycogen synthase and branching enzyme. It contains a conserved DxD motif and an N-terminal beta-alpha-beta Rossmann-like fold that are common to the nucleotide-binding domains of most glycosyltransferases. The DxD motif is essential for coordination of the catalytic divalent cation, most commonly Mn2+. Glycogenin can be classified as a retaining glycosyltransferase, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. It is placed in glycosyltransferase family 8 which includes lipopolysaccharide glucose and galactose transferases and galactinol synthases.
227884	Gnt1	4.67e-06	70	293	70	277	Alpha-N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOW27523.1|GT8	0.0	1	462	1	462
AAV04198.1|GT8	0.0	16	462	9	455
CCE43359.1|GT8	2.56e-222	2	462	6	469
CCG21314.1|GT8	2.97e-221	3	462	7	469
ABN66322.2|GT8	3.35e-188	4	460	8	476

PDB Hits     

C2_05050C_A-T-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q59ZI3|GNT1_CANAL	0.0	1	462	1	462	Glucose N-acetyltransferase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=GNT1 PE=3 SV=1
sp|Q6BUZ2|GNT1_DEBHA	5.58e-128	14	460	13	462	Glucose N-acetyltransferase 1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / BCRC 21394 / JCM 1990 / NBRC 0083 / IGC 2968) OX=284592 GN=GNT1 PE=3 SV=2
sp|Q4HVS2|GNT1_GIBZE	3.50e-25	70	400	154	392	Glucose N-acetyltransferase 1 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GNT1 PE=3 SV=2
sp|Q6CT96|GNT1B_KLULA	9.94e-21	69	400	83	412	Glucose N-acetyltransferase 1-B OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) OX=284590 GN=GNT1-B PE=3 SV=1
sp|Q9Y761|GNT1A_KLULA	2.00e-19	66	423	89	438	Glucose N-acetyltransferase 1-A OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) OX=284590 GN=GNT1-A PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000035	0.000004

TMHMM  Annotations     

There is no transmembrane helices in C2_05050C_A-T-p1.