CAZyme Information: C2_03070C_B-T-p1

Basic Information

• Species: Candida albicans
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Candida; Candida albicans
• CAZyme ID: C2_03070C_B-T-p1
• CAZy Family: GH16
• CAZyme Description: Mannosyltransferase of glycosylphosphatidylinositol (GPI) biosynthesis, catalyzes mannosylation of Man3-GPI precursor, essential for viability, 8-9 transmembrane regions predicted, has HQEXRF motif, functional homolog of S. cerevisiae Smp3p

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
498		57897.72	7.0014

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CalbicansSC5314_B	6415	N/A	215	6200

• Gene Location: location=Ca22chr2B_C_albicans_SC5314:618204-619700(-)

Full Sequence      

MIKINFNWRTFYLLTIVFRFVFTLSDSYIHPDEHFQSLEVLTNRILNYSTNIPWEFQDDP
ARSLAPLYFIYGPLLYFIKFFKLNLTALQIWYIARLQISILSWIITDFCLYWMLPSKPER
IKAIFFTSTSYITLVYQNHLFSNSIETLLLLVTILLIDDLRYVQESKDQDVQNLNKNKNL
FYTGVLISLGIFNRITFPAFLILPGWFVIKYVLKHYVSGLYLVMGFFSTTALLILVDTIL
FGNINNVVAEAFNISSYIIAPLNNLLYNAKYENLAQHGIHPYYTHILVNMPQILGPGLIF
FVSKSYTKTTPFLTVISGLLFLSVIPHQELRFLIPLLPLACCSFDFTLKWVQPWMLYTWY
IFNIFMSILMGKLHQGGVVPVLDHIKSEASVQVWWRTYTPPSWILGSNSTETTHLGEKLN
DNIFINIVDCMGADSKEVQQILQTISTNKPVYLITPIASFKHFDESRFSPVWNYTFHLDL
DHLDFADIQPGLGVYQLL

Enzyme Prediction     

No EC number prediction in C2_03070C_B-T-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT22	12	404	3.8e-71	0.987146529562982

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
281842	Glyco_transf_22	1.84e-42	10	403	1	410	Alg9-like mannosyltransferase family. Members of this family are mannosyltransferase enzymes. At least some members are localized in endoplasmic reticulum and involved in GPI anchor biosynthesis.
215437	PLN02816	1.06e-07	9	389	39	427	mannosyltransferase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOW27344.1|GT22	0.0	1	498	1	498
CAX43561.1|GT22	0.0	1	498	9	506
CCG21479.1|GT22	1.28e-217	7	498	39	518
CCE43516.1|GT22	8.79e-205	7	498	6	485
ABN64303.2|GT22	9.08e-198	6	498	5	507

PDB Hits     

C2_03070C_B-T-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5A0L9|SMP3_CANAL	0.0	1	498	1	498	GPI mannosyltransferase 4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SMP3 PE=3 SV=2
sp|Q6BJ96|SMP3_DEBHA	3.04e-183	2	498	3	535	GPI mannosyltransferase 4 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / BCRC 21394 / JCM 1990 / NBRC 0083 / IGC 2968) OX=284592 GN=SMP3 PE=3 SV=2
sp|Q6CU99|SMP3_KLULA	1.89e-92	14	497	9	501	GPI mannosyltransferase 4 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) OX=284590 GN=SMP3 PE=3 SV=2
sp|Q6CDD0|SMP3_YARLI	1.86e-90	7	498	4	510	GPI mannosyltransferase 4 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=SMP3 PE=3 SV=1
sp|Q04174|SMP3_YEAST	6.13e-90	24	497	20	513	GPI mannosyltransferase 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SMP3 PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.248537	0.751440	CS pos: 27-28. Pr: 0.6985

TMHMM  Annotations     

Start	End
5	22
64	81
93	115
135	157
180	202
217	236
311	330
350	369