CAZyme Information: C2_01360C_B-T-p1

Basic Information

• Species: Candida albicans
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Candida; Candida albicans
• CAZyme ID: C2_01360C_B-T-p1
• CAZy Family: GH16
• CAZyme Description: Protein with predicted GPI modification, dfg5 dcw1 double mutant is inviable, not required for wild-type hyphal growth, upregulated in cyr1 mutant (yeast or hyphal form), Hap43-induced

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
452		50348.44	4.3185

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CalbicansSC5314_B	6415	N/A	215	6200

• Gene Location: location=Ca22chr2B_C_albicans_SC5314:234996-236354(-)

Full Sequence      

MKFSIYLIISLFSSFSHAIWLDTNNETTIREDCNIIAKGLLDYYEGTKYGGVIGMFSWPY
YWWEAGGAWGSLIDYTFYFDNDTLVPLITDALLYQTGDDDNYIPLNQSTTEGNDDQAFWG
IAVMAAAERNFTNPKDPTKAWLTLAQAVFNTMQARWDTETCNGGLRWQIFQWNSGYDYKN
SVSNGALFHLAARLARYTGNDSYVVWAERVWDWMYGVGLLTEQNWWFVYDGVKIANNCSN
ITKYQWSYNQGLMLAGCAYLYNYTEEEKWYNYTIKLLESAQVFFKNISGSMVMYEAACQP
SNSCNNDQRSFKAYFSRFLGLTSVLVPQTEPVITKWLVDSANGAAGSCSGGSDGVTCGLS
WTDWSQGWDGKWGLGEQMSALEVMQNLMVHKRPAPYTADTGGSSIGNPAAGYGKLTSDAT
PLSIDGGDKAGAGIITAIIGASLVGSCVWLIL

Enzyme Prediction     

No EC number prediction in C2_01360C_B-T-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	26	398	1.1e-105	0.9636871508379888

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397638	Glyco_hydro_76	1.00e-180	28	381	1	348	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.
227170	COG4833	4.99e-06	170	331	136	286	Predicted alpha-1,6-mannanase, GH76 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOW27182.1|GH76	0.0	1	452	1	452
CAX43402.1|GH76	0.0	1	452	1	452
CCG21711.1|GH76	2.15e-266	4	452	6	455
CCE43752.1|GH76	1.45e-264	1	452	1	455
SGZ54171.1|GH76	3.10e-245	1	452	1	455

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6RY0_A	7.69e-85	21	429	30	443	Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY1_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY2_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY5_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY6_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY7_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5AD78|DCW1_CANAL	0.0	1	452	1	452	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=DCW1 PE=1 SV=1
sp|Q75DG6|DCW1_ASHGO	3.06e-197	3	452	6	451	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) OX=284811 GN=DCW1 PE=3 SV=2
sp|P36091|DCW1_YEAST	1.26e-193	15	451	18	448	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DCW1 PE=1 SV=1
sp|Q6FLP9|DCW1_CANGA	1.26e-185	8	451	10	445	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) OX=284593 GN=DCW1 PE=3 SV=1
sp|Q05031|DFG5_YEAST	6.15e-157	16	451	24	457	Mannan endo-1,6-alpha-mannosidase DFG5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DFG5 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000258	0.999704	CS pos: 18-19. Pr: 0.9766

TMHMM  Annotations     

There is no transmembrane helices in C2_01360C_B-T-p1.