CAZyme Information: C1_06940C_B-T-p1

Basic Information

• Species: Candida albicans
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Candida; Candida albicans
• CAZyme ID: C1_06940C_B-T-p1
• CAZy Family: CBM48
• CAZyme Description: Cell wall acid trehalase, catalyzes hydrolysis of the disaccharide trehalose, similar to S. cerevisiae vacuolar acid trehalase (Ath1p), Hap43p-repressed gene

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1078		120237.65	4.8022

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CalbicansSC5314_B	6415	N/A	215	6200

• Gene Location: location=Ca22chr1B_C_albicans_SC5314:1479765-1483001(-)

Full Sequence      

MAANSSFFLADNCAPHNQSFIQFCIHAASKKKGWIALMCLANLFLLFSFHLLYARFCSGF
PYVVPSTARSTNQIFHTNLEQLVNSPENKQIFSQLKFSDQAFYDPHDNVVGTTEFPVFNQ
YQRQPYVANGYIGSRIPNLGQGFTYDQLTNSSTANDDDLLNGWPLFNKRYSGAFVAGFYD
LQKNTTGTNFAELLENGYESVIAAVPQWTALSLSVEILGKKYTLDPSLEHEAIGDITNYV
QNMSLSDGIVTTQFTWLNTFDVKYEILAHRENINLGLVNMQVYNPGNESVQVIVSDVLDF
NSSQRCQLNQISHDKNGIYVTFHPQGLSYIDGAIYSTLSANGQITREQTNETVFQNVELT
IEPHSCVQVAKYAGIATTDLDPDSFKTADDVLKFARKVSQNKKHGDATQLVNSHRSAWSK
IIQDAPLVTFPSDSLLNLGARASIFHLLANTRPNAEGVTGALGVSGLSSDSYGGMVFWDT
DLWMLNGILPFAPDHIKSFINYRVHLHQQAIDNVPRGYQGAVYPWTSGRFGNCTGTGPCL
DYEYHINMAVAMASWQLYISGAADDTFLESVAYPIINDAASFLAEYVVHYNDTLGKYTTK
NLTDPDEFANHVDNGAYTNTGIVLVMRWAQIAGSILGKQVPKIYHDIETAMFLPTAENTQ
NITLEYSGMNSSVGIKQADVIMMTYPLENELIDQDQAYINMEFYSMKQVGYGPAMTFPIF
SIVASNLAFTGCASQSYLHKAIQPFLRGPFAQFAEQNNDDYLTNGGTHPAFPFLTAHGGF
LQAILQGLTGMRFDYTFENNKLQRLLKLDPIALPCLGEGVRFDSIKYDNHTLSMAINETH
FTIKNKGKTTPNARNYVTILLAERNAMHGKYTINDEDEQSFPLFETSESFPDSISECNKA
GFFNITEGAYGDVSISINDGDNTTSWQAKYNDTTGKVLVDLKSFRNISSGTFIWGDKPPK
RVKVSKYSGSSFTAVTDFFAQVDFGNELFNEYKYANPEGKLHNQSDVFEEVYSGDVKISA
PFDPEEYFQVWVPTRHNITEVAVNLQTRFLLIEVDEIHNTEAIDGDYGGAKLAEVVFY

Enzyme Prediction     

EC	3.2.1.28:7

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH65	441	794	4.5e-86	0.9919354838709677

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224471	ATH1	1.46e-89	127	851	32	748	Trehalose and maltose hydrolase (possible phosphorylase) [Carbohydrate transport and metabolism].
281612	Glyco_hydro_65m	2.06e-37	441	794	1	383	Glycosyl hydrolase family 65 central catalytic domain. This family of glycosyl hydrolases contains vacuolar acid trehalase and maltose phosphorylase.Maltose phosphorylase (MP) is a dimeric enzyme that catalyzes the conversion of maltose and inorganic phosphate into beta-D-glucose-1-phosphate and glucose. The central domain is the catalytic domain, which binds a phosphate ion that is proximal the the highly conserved Glu. The arrangement of the phosphate and the glutamate is thought to cause nucleophilic attack on the anomeric carbon atom. The catalytic domain also forms the majority of the dimerization interface.
397616	Glyco_hydro_65N	1.26e-20	103	378	5	240	Glycosyl hydrolase family 65, N-terminal domain. This family of glycosyl hydrolases contains vacuolar acid trehalase and maltose phosphorylase.Maltose phosphorylase (MP) is a dimeric enzyme that catalyzes the conversion of maltose and inorganic phosphate into beta-D-glucose-1-phosphate and glucose. This domain is believed to be essential for catalytic activity although its precise function remains unknown.
237517	PRK13807	1.50e-14	367	845	253	731	maltose phosphorylase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOW26348.1|GH65	0.0	1	1078	1	1078
AAV05390.1|GH65|3.2.1.28	0.0	1	1078	24	1101
CAX44942.1|GH65	0.0	1	1078	1	1078
CCG21210.1|GH65	0.0	30	1078	26	1070
CCE43253.1|GH65|3.2.1.28	0.0	30	1078	26	1071

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7FE3_A	4.16e-46	175	820	62	669	Chain A, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101],7FE3_B Chain B, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101],7FE3_C Chain C, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101],7FE4_A Chain A, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101],7FE4_B Chain B, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101],7FE4_C Chain C, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101]
3WIQ_A	7.95e-27	386	846	254	739	Crystal structure of kojibiose phosphorylase complexed with kojibiose [Caldicellulosiruptor saccharolyticus DSM 8903],3WIR_A Crystal structure of kojibiose phosphorylase complexed with glucose [Caldicellulosiruptor saccharolyticus DSM 8903],3WIR_B Crystal structure of kojibiose phosphorylase complexed with glucose [Caldicellulosiruptor saccharolyticus DSM 8903],3WIR_C Crystal structure of kojibiose phosphorylase complexed with glucose [Caldicellulosiruptor saccharolyticus DSM 8903],3WIR_D Crystal structure of kojibiose phosphorylase complexed with glucose [Caldicellulosiruptor saccharolyticus DSM 8903]
4KTP_A	1.65e-19	323	848	181	736	Chain A, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTP_B Chain B, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10]
4KTR_A	3.77e-19	323	848	181	736	Chain A, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_B Chain B, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_C Chain C, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_D Chain D, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_E Chain E, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_F Chain F, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_G Chain G, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_H Chain H, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5AAU5|ATC1_CANAL	0.0	1	1078	1	1078	Cell wall acid trehalase ATC1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ATC1 PE=1 SV=2
sp|M1RNJ8|ATH1_CANGB	5.50e-227	89	1066	148	1157	Periplasmic/secreted acid trehalase ATH1 OS=Candida glabrata OX=5478 GN=ATH1 PE=1 SV=1
sp|P48016|ATH1_YEAST	2.85e-219	89	991	112	1065	Periplasmic acid trehalase ATH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ATH1 PE=1 SV=1
sp|N1P212|ATH1_YEASC	2.85e-219	89	991	112	1065	Periplasmic acid trehalase ATC1 OS=Saccharomyces cerevisiae (strain CEN.PK113-7D) OX=889517 GN=CENPK1137D_1727 PE=1 SV=1
sp|D4B5H9|ATC1_ARTBC	2.25e-120	121	964	79	944	Cell wall acid trehalase ARB_03719 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_03719 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999999	0.000006

TMHMM  Annotations     

Start	End
33	52