CAZyme Information: C1_04280C_B-T-p1

Basic Information

• Species: Candida albicans
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Candida; Candida albicans
• CAZyme ID: C1_04280C_B-T-p1
• CAZy Family: AA7
• CAZyme Description: Ortholog(s) have alpha-1,6-mannosyltransferase activity, mannosyltransferase activity and role in GPI anchor biosynthetic process

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
394		45610.98	9.3008

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CalbicansSC5314_B	6415	N/A	215	6200

• Gene Location: location=Ca22chr1B_C_albicans_SC5314:884590-885774(-)

Full Sequence      

MLWKLLRLFIIIKLIQLAIIYFSPCQFDTSSELIIQNLSSTSSSKSYYNVIITTILNKLI
VWDSVYFNDLFINPIQFEHQFVFCPGWIQLIKLLNIKNYYTAQLTSILISNLCHFASVIT
LYYLTNEMDMKFGLVSGLLMIISPAGVFLTGNYSENLSNLLTLLMFLTYYKSINFNDVKQ
PSNKSITNILGYIISGIFCAINFTVRANGLLLGVIYVFDLYHFIQNKSSSQIILSIITGS
ILFMTFLMTNIYHYIKFCPGREWCNNTFPSLFQFAQHHYWNVGFLKYWTPNNIPNFILVL
PVLIFNIYSLGYMYQELPKNRKLLPLIVINGLIVVGGTFFWNIQILNRITSFSPLIYWTL
AYNLKKPWAKYAIGYCIVWNFVQTGLFAAFLPPA

Enzyme Prediction     

No EC number prediction in C1_04280C_B-T-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT76	6	394	5.7e-106	0.995085995085995

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
282094	Mannosyl_trans2	2.30e-35	5	394	4	439	Mannosyltransferase (PIG-V). This is a family of eukaryotic ER membrane proteins that are involved in the synthesis of glycosylphosphatidylinositol (GPI), a glycolipid that anchors many proteins to the eukaryotic cell surface. Proteins in this family are involved in transferring the second mannose in the biosynthetic pathway of GPI.
227829	COG5542	1.15e-15	8	394	6	408	Mannosyltransferase related to Gpi18 [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOW26102.1|GT76	7.07e-290	1	394	1	394
CAX44663.1|GT76	1.49e-235	2	394	75	485
CCG22525.1|GT76	5.44e-178	2	394	37	432
CCE40664.1|GT76	5.86e-170	4	394	8	401
ABN67789.1|GT76	5.73e-124	4	394	8	394

PDB Hits     

C1_04280C_B-T-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q59VN0|GPI18_CANAL	1.26e-290	1	394	1	394	GPI mannosyltransferase 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=GPI18 PE=3 SV=1
sp|Q6BRZ9|GPI18_DEBHA	6.36e-105	7	394	9	428	GPI mannosyltransferase 2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / BCRC 21394 / JCM 1990 / NBRC 0083 / IGC 2968) OX=284592 GN=GPI18 PE=3 SV=1
sp|Q6C216|GPI18_YARLI	6.32e-57	9	394	11	357	GPI mannosyltransferase 2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=GPI18 PE=3 SV=1
sp|Q6CMW6|GPI18_KLULA	4.00e-56	9	394	17	417	GPI mannosyltransferase 2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) OX=284590 GN=GPI18 PE=3 SV=1
sp|Q757K7|GPI18_ASHGO	1.24e-51	4	394	6	427	GPI mannosyltransferase 2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) OX=284811 GN=GPI18 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.760284	0.239716

TMHMM  Annotations     

Start	End
5	22
103	125
132	154
189	211
232	254
288	310
323	345
371	393