CAZyme Information: C1_02990C_B-T-p1

Basic Information

• Species: Candida albicans
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Candida; Candida albicans
• CAZyme ID: C1_02990C_B-T-p1
• CAZy Family: AA4
• CAZyme Description: Exo-1,3-beta-glucanase, 5 glycosyl hydrolase family member, affects sensitivity to chitin and glucan synthesis inhibitors, not required for yeast-to-hypha transition or for virulence in mice, Hap43-induced, Spider biofilm induced

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
438	Ca22chr1B_C_albicans_SC5314|CGC2	50037.84	5.3727

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CalbicansSC5314_B	6415	N/A	215	6200

• Gene Location: location=Ca22chr1B_C_albicans_SC5314:622252-623568(-)

Full Sequence      

MQLSFILTSSVFILLLEFVKASVISNPFKPNGNLKFKRGGGHNVAWDYDNNVIRGVNLGG
WFVLEPYMTPSLFEPFQNGNDQSGVPVDEYHWTQTLGKEAASRILQKHWSTWITEQDFKQ
ISNLGLNFVRIPIGYWAFQLLDNDPYVQGQVQYLEKALGWARKNNIRVWIDLHGAPGSQN
GFDNSGLRDSYNFQNGDNTQVTLNVLNTIFKKYGGNEYSDVVIGIELLNEPLGPVLNMDK
LKQFFLDGYNSLRQTGSVTPVIIHDAFQVFGYWNNFLTVAEGQWNVVVDHHHYQVFSGGE
LSRNINDHISVACNWGWDAKKESHWNVAGEWSAALTDCAKWLNGVNRGARYEGAYDNAPY
IGSCQPLLDISQWSDEHKTDTRRYIEAQLDAFEYTGGWVFWSWKTENAPEWSFQTLTYNG
LFPQPVTDRQFPNQCGFH

Enzyme Prediction     

EC	3.2.1.58:29	3.2.1.21:6	3.2.1.75:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	107	406	2.9e-129	0.9966996699669967

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225344	BglC	4.88e-81	47	436	12	395	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
395098	Cellulase	1.14e-06	97	256	5	158	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAA39908.1|GH5_9|3.2.1.58	0.0	1	438	1	438
AOW25980.1|GH5_9	0.0	1	438	1	438
CAA21969.1|GH5_9|3.2.1.58	0.0	1	438	1	438
CAX44539.1|GH5_9	0.0	1	438	1	438
AAV05307.1|GH5_9|3.2.1.58	0.0	16	438	9	431

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2PF0_A	0.0	39	438	1	400	Chain A, Hypothetical protein XOG1 [Candida albicans]
2PBO_A	0.0	39	438	1	400	Chain A, Hypothetical protein XOG1 [Candida albicans]
2PC8_A	0.0	39	438	1	400	Chain A, Hypothetical protein XOG1 [Candida albicans]
2PB1_A	0.0	39	438	1	400	Exo-B-(1,3)-Glucanase from Candida Albicans in complex with unhydrolysed and covalently linked 2,4-dinitrophenyl-2-deoxy-2-fluoro-B-D-glucopyranoside at 1.9 A [Candida albicans]
3O6A_A	0.0	40	438	1	399	F144Y/F258Y Double Mutant of Exo-beta-1,3-glucanase from Candida albicans at 2 A [Candida albicans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P29717|EXG1_CANAL	0.0	1	438	1	438	Glucan 1,3-beta-glucosidase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=XOG1 PE=1 SV=5
sp|Q12700|EXG_SCHOC	3.32e-215	44	437	33	425	Glucan 1,3-beta-glucosidase OS=Schwanniomyces occidentalis OX=27300 PE=3 SV=1
sp|Q8NKF9|EXG_CANOL	5.40e-207	14	437	1	425	Glucan 1,3-beta-glucosidase OS=Candida oleophila OX=45573 GN=EXG1 PE=3 SV=1
sp|O93983|EXG2_WICAO	1.05e-202	14	435	2	426	Glucan 1,3-beta-glucosidase 2 OS=Wickerhamomyces anomalus OX=4927 GN=EXG2 PE=3 SV=1
sp|Q875R9|EXG_LACK1	7.60e-189	27	437	22	439	Glucan 1,3-beta-glucosidase OS=Lachancea kluyveri (strain ATCC 58438 / CBS 3082 / BCRC 21498 / NBRC 1685 / JCM 7257 / NCYC 543 / NRRL Y-12651) OX=226302 GN=EXG1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000205	0.999766	CS pos: 21-22. Pr: 0.9802

TMHMM  Annotations     

There is no transmembrane helices in C1_02990C_B-T-p1.