CAZyme Information: C1_02520W_B-T-p1

Basic Information

• Species: Candida albicans
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Candida; Candida albicans
• CAZyme ID: C1_02520W_B-T-p1
• CAZy Family: AA3
• CAZyme Description: Putative cell wall protein, substrate for Kex2p processing in vitro, expression regulated by white-opaque switch, alkaline repressed, possibly essential (UAU1 method), flow model biofilm induced, Spider biofilm induced

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
578		57503.28	4.4487

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CalbicansSC5314_B	6415	N/A	215	6200

• Gene Location: location=Ca22chr1B_C_albicans_SC5314:530205-531941(+)

Full Sequence      

MKLDYILASLVIASITEAAPIKRGLLDDLFGTSSSNTAAAAPAAAPAPAAAPAVAPAAQQ
AANVNTAPAVSPAATTTAAAASSKGFWAGLFDGGSTNTASTAAAPAAPAQAPVSVASAAA
APAVAVAVAPAASTPKSTSSSSSFGGFFSNLYNDFFGSSSSSSSANANSQPQAPAQAQAP
VQVTKPTAAAPVVVTSEQVYTSVVTSATAAPAAAATASSDSDDYSAEGLFGFLFGGGSDG
GKASAAASASGSVSLNPIDGSGLGSGSGSGNSAGNSGSSSGTTLGIGYQGGSPGKNTASI
NTATATAVNGGSAAGATAAAGSLGITYSPYTKSDGCKSASQIAQDIAKLSNYEVIRLYST
DCSGIENVLSAMGSNQKLFLGVWNIDSPQGELQDIVSAIKQSSSGWNVVHTIAIGNERVN
AGAASVAQVQQAVDISKKYLKSQGYNGPIVTVDTLVAYVGNPQLCEMSDYLAVNSHPYWD
GGVQPENSGQWLLQQIAHLQSVCGSSKDVLITETGWPTQGDSYGQCVPSVQNQVAAVKSI
VKSLSDKVIMFTMFNDYWKDPGAYNVEQHWGLYGDPSS

Enzyme Prediction     

No EC number prediction in C1_02520W_B-T-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH17	324	573	1e-26	0.954983922829582

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	7.23e-74	299	573	22	301	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
366033	Glyco_hydro_17	5.39e-09	350	573	35	297	Glycosyl hydrolases family 17.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABU33907.1|GH17	3.12e-251	1	578	1	578
AOW25936.1|GH17	3.12e-251	1	578	1	578
AAV02891.1|GH17	7.35e-237	181	578	14	411
CAX44497.1|GH17	1.68e-230	1	578	1	574
CCG22480.1|GH17	5.39e-154	288	577	246	539

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WTP_A	5.78e-12	324	574	39	283	Crystal structure of glycoside hydrolase family 17 beta-1,3-glucanosyltransferase from Rhizomucor miehei [Rhizomucor miehei CAU432]
4WTR_A	3.36e-11	324	574	39	283	Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaribiose [Rhizomucor miehei CAU432],4WTS_A Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaritriose [Rhizomucor miehei CAU432]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q59XX2|MP65_CANAL	9.23e-89	315	575	119	378	Cell surface mannoprotein MP65 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MP65 PE=1 SV=3
sp|P53334|SCW4_YEAST	4.72e-84	319	572	130	382	Probable family 17 glucosidase SCW4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SCW4 PE=1 SV=1
sp|Q04951|SCW10_YEAST	4.00e-83	319	572	133	385	Probable family 17 glucosidase SCW10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SCW10 PE=1 SV=1
sp|Q2US39|BTGE_ASPOR	2.53e-45	323	571	347	596	Probable beta-glucosidase btgE OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=btgE PE=3 SV=1
sp|B8MXP5|BTGE_ASPFN	2.53e-45	323	571	347	596	Probable beta-glucosidase btgE OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=btgE PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000278	0.999719	CS pos: 18-19. Pr: 0.9670

TMHMM  Annotations     

There is no transmembrane helices in C1_02520W_B-T-p1.