CAZyme Information: C1_01360C_A-T-p1

Basic Information

• Species: Candida albicans
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Candida; Candida albicans
• CAZyme ID: C1_01360C_A-T-p1
• CAZy Family: AA1
• CAZyme Description: Glycogenin glucosyltransferase [Source:UniProtKB/TrEMBL;Acc:A0A1D8PCG4]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
660	Ca22chr1A_C_albicans_SC5314|CGC11	75977.27	4.2473

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CalbicansSC5314	6468	237561	256	6212

• Gene Location: location=Ca22chr1A_C_albicans_SC5314:265483-267465(-)

Full Sequence      

MTNAVFTLLYNPDYLAGALVLGSVLKKLVLRSDQKYPDLKFGILIDKSKFTSYQLQLLSR
YYDDLIDVSPLKSTIVEKLTYDLKRPELDKTFTKVELWSLIQYEKILYLDSDTLPIIPDA
ANGGTVLDLLALDFPKFKILAAPDSGFPDIFNSGVFALRPNLDDYTNLAALVQESVINPN
VSFDGADQGLLNQYFNAQPDWVQALLTKHDATVDLETVSYTQDSNWIKIPFLYNVTPSAE
YQYLPALKHFQNPPGQPSLLENPQAEAELVDQGAEQPKHDKELWESTFDTIGRYHSTALS
YINYKTTQVKVVHFIGKYKPWRSSSNVSGVHRDWWKAWIEEFGEKSLFDVVYGEKSLEKE
PQTDYTPEPSRQEYPKEEPTEICEVKAEPAPEPPLDTSDPHVLLDPANYQRFEDRIQPSI
DAMWDPTKEPPPKREDVKEEETHDFLEKVPKSFAKEWDSSTHYHHPPEEYEGVHDTQHHI
EPYHQEEIQKNDQYNLEKDVQPPNNELHISPFEHQEHDHAPEHTPSNIPPERPELYGHKF
VEPERVFDTADDYFPTHILQEVEKINISNKPDTEAEVEPTSASELATDVTAFNLMNDKLS
KEGAIEESAFEEIYTEDNEEIDGEISEDDILEEEEEEVVPKLFPWEFRESGKVVAERVFD

Enzyme Prediction     

No EC number prediction in C1_01360C_A-T-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT8	3	323	1.1e-40	0.8793774319066148

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133018	GT8_Glycogenin	1.46e-44	7	340	5	239	Glycogenin belongs the GT 8 family and initiates the biosynthesis of glycogen. Glycogenin initiates the biosynthesis of glycogen by incorporating glucose residues through a self-glucosylation reaction at a Tyr residue, and then acts as substrate for chain elongation by glycogen synthase and branching enzyme. It contains a conserved DxD motif and an N-terminal beta-alpha-beta Rossmann-like fold that are common to the nucleotide-binding domains of most glycosyltransferases. The DxD motif is essential for coordination of the catalytic divalent cation, most commonly Mn2+. Glycogenin can be classified as a retaining glycosyltransferase, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. It is placed in glycosyltransferase family 8 which includes lipopolysaccharide glucose and galactose transferases and galactinol synthases.
132996	Glyco_transf_8	8.72e-13	4	250	2	228	Members of glycosyltransferase family 8 (GT-8) are involved in lipopolysaccharide biosynthesis and glycogen synthesis. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. GT-8 comprises enzymes with a number of known activities: lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, glycogenin glucosyltransferase, and N-acetylglucosaminyltransferase. GT-8 enzymes contains a conserved DXD motif which is essential in the coordination of a catalytic divalent cation, most commonly Mn2+.
279798	Glyco_transf_8	3.62e-09	7	323	3	250	Glycosyl transferase family 8. This family includes enzymes that transfer sugar residues to donor molecules. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. This family includes Lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, and glycogenin glucosyltransferase.
236669	PRK10263	1.03e-04	360	591	338	566	DNA translocase FtsK; Provisional
226435	COG3921	2.34e-04	351	441	32	116	Uncharacterized conserved protein [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOW25829.1|GT8	0.0	1	660	1	660
CAX44388.1|GT8	0.0	1	660	1	666
CCE40878.1|GT8	1.74e-185	1	660	1	605
CCG22727.1|GT8	3.56e-175	1	660	1	609
CAY34854.1|GT8	2.12e-120	1	473	1	433

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3T7M_A	6.34e-31	1	250	2	205	Crystal Structure of Human Glycogenin-1 (GYG1) complexed with manganese and UDP, in a triclinic closed form [Homo sapiens],3T7M_B Crystal Structure of Human Glycogenin-1 (GYG1) complexed with manganese and UDP, in a triclinic closed form [Homo sapiens],3T7N_A Crystal Structure of Human Glycogenin-1 (GYG1) complexed with manganese and UDP, in a monoclinic closed form [Homo sapiens],3T7N_B Crystal Structure of Human Glycogenin-1 (GYG1) complexed with manganese and UDP, in a monoclinic closed form [Homo sapiens],3T7O_A Crystal Structure of Human Glycogenin-1 (GYG1) complexed with manganese, UDP-Glucose and glucose [Homo sapiens],3T7O_B Crystal Structure of Human Glycogenin-1 (GYG1) complexed with manganese, UDP-Glucose and glucose [Homo sapiens],3U2U_A Crystal Structure of Human Glycogenin-1 (GYG1) complexed with manganese, UDP and maltotetraose [Homo sapiens],3U2U_B Crystal Structure of Human Glycogenin-1 (GYG1) complexed with manganese, UDP and maltotetraose [Homo sapiens],3U2V_A Crystal Structure of Human Glycogenin-1 (GYG1) complexed with manganese, UDP and maltohexaose [Homo sapiens],3U2V_B Crystal Structure of Human Glycogenin-1 (GYG1) complexed with manganese, UDP and maltohexaose [Homo sapiens],3U2X_A Crystal Structure of Human Glycogenin-1 (GYG1) complexed with manganese, UDP and 1'-deoxyglucose [Homo sapiens],3U2X_B Crystal Structure of Human Glycogenin-1 (GYG1) complexed with manganese, UDP and 1'-deoxyglucose [Homo sapiens]
1ZCT_A	8.67e-31	1	250	21	224	structure of glycogenin truncated at residue 270 in a complex with UDP [Oryctolagus cuniculus],1ZCT_B structure of glycogenin truncated at residue 270 in a complex with UDP [Oryctolagus cuniculus]
3V8Y_A	8.86e-31	1	250	21	224	Structure of apo-glycogenin truncated at residue 270 [Oryctolagus cuniculus],3V8Z_A Structure of apo-glycogenin truncated at residue 270 complexed with UDP [Oryctolagus cuniculus]
3U2T_A	1.03e-30	1	250	23	226	Crystal Structure of Human Glycogenin-1 (GYG1) complexed with manganese [Homo sapiens]
1LL2_A	2.14e-30	1	250	1	204	Crystal Structure of Rabbit Muscle Glycogenin Complexed with UDP-glucose and Manganese [Oryctolagus cuniculus],1LL3_A Crystal Structure of Rabbit Muscle Glycogenin [Oryctolagus cuniculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A6ZQJ2|GLG2_YEAS7	2.14e-36	4	251	6	242	Glycogenin-2 OS=Saccharomyces cerevisiae (strain YJM789) OX=307796 GN=GLG2 PE=3 SV=1
sp|P47011|GLG2_YEAST	5.45e-36	4	251	6	242	Glycogenin-2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GLG2 PE=1 SV=1
sp|Q9R062|GLYG_MOUSE	4.31e-32	1	290	1	255	Glycogenin-1 OS=Mus musculus OX=10090 GN=Gyg1 PE=1 SV=3
sp|O08730|GLYG_RAT	2.02e-31	1	250	1	204	Glycogenin-1 OS=Rattus norvegicus OX=10116 GN=Gyg1 PE=2 SV=4
sp|A7A018|GLG1_YEAS7	1.71e-30	4	368	6	304	Glycogenin-1 OS=Saccharomyces cerevisiae (strain YJM789) OX=307796 GN=GLG1 PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000055	0.000001

TMHMM  Annotations     

There is no transmembrane helices in C1_01360C_A-T-p1.