CAZyme Information: Bcin16g04140.2:RNA-p1

Basic Information

• Species: Botrytis cinerea
• Lineage: Ascomycota; Leotiomycetes; ; Sclerotiniaceae; Botrytis; Botrytis cinerea
• CAZyme ID: Bcin16g04140.2:RNA-p1
• CAZy Family: GT69
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
340		37995.48	6.2166

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_BcinereaB05-10	12073	332648	366	11707

• Gene Location: location=bcin_chr_16:1500807-1501895(-)

Full Sequence      

MRILGPFIAFPLLMECGKAQDPARIPTNFPFFANGVSSAPYLANIANMDEFHKIKGNLTF
TSQGPIHVYVNVGATQQALFLEGVLYNHAYVPVPLRTSGKPERPQIKPGEVLVEGNTEKF
WAQGTAYTRRDIVQYGCNDNGTRCDSEGFRYRENGDIYNINEATFNPKGNGHVHDGGAHM
DHSLVDGYTTPMIVVPENYECLPYGCTEDPTGDWCPNTHKVFLGDESNHAGCASDCKIYN
TDAACCRGAYNHNQCRASSQHFSKRCKNSYAYAYDDKVGLRFCKDVPKVIYHFFNMKLDC
DWAVINPDSKNLSVDSRECLDRLIQAPTRQDDSFYEGSSA

Enzyme Prediction     

No EC number prediction in Bcin16g04140.2:RNA-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH152	177	285	1.2e-21	0.5185185185185185

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395248	Thaumatin	9.54e-21	175	284	86	200	Thaumatin family.
185757	TLP-PA	5.30e-17	181	277	103	202	allergenic/antifungal thaumatin-like proteins: plant and animal homologs. This subfamily is represented by the thaumatin-like proteins (TLPs), Cherry Allergen Pru Av 2 TLP, Peach PpAZ44 TLP (a propylene-induced TLP in abscission), the Caenorhabditis elegans thaumatin family member (thn-6), and other plant and animal homologs. TLPs are involved in host defense and a wide range of developmental processes in fungi, plants, and animals. Due to their inducible expression by environmental stresses such as pathogen/pest attack, drought and cold, plant TLPs are classified as the pathogenesis-related (PR) protein family 5 (PR5). Several members of the plant TLP family have been reported as food allergens from fruits (i.e., cherry, Pru av 2; bell pepper, Cap a1; tomatoes, Lyc e NP24) and pollen allergens from conifers (i.e., mountain cedar, Jun a 3; Arizona cypress, Cup a3; Japanese cedar, Cry j3). TLPs are three-domain, crescent-fold structures with either an electronegative, electropositive, or neutral cleft occurring between domains I and II. It has been proposed that the antifungal activity of plant PR5 proteins relies on the strong electronegative character of this cleft. Some TLPs hydrolyze the beta-1,3-glucans of the type commonly found in fungal walls. TLPs within this subfamily contain 16 conserved Cys residues.
128501	THN	6.71e-13	181	283	102	206	Thaumatin family. The thaumatin family gathers proteins related to plant pathogenesis. The thaumatin family includes very basic members with extracellular and vacuolar localization. Thaumatin itsel is a potent sweet-tasting protein. Several members of this family display significant in vitro activity of inhibiting hyphal growth or spore germination of various fungi probably by a membrane permeabilizing mechanism.
185758	TLP-F	1.61e-06	162	291	93	223	thaumatin-like proteins: basidiomycete homologs. This subfamily is represented by Lentinula edodes TLG1, a thaumatin-like protein (TLP), as well as, other basidiomycete homologs. In general, TLPs are involved in host defense and a wide range of developmental processes in fungi, plants, and animals. TLG1 TLP is involved in lentinan degradation and fruiting body senescence. TLG1 expressed in Escherichia coli and Aspergillus oryzae exhibited beta-1,3-glucanase activity and demonstrated lentinan degrading activity. TLG1 is proposed to be involved in lentinan and cell wall degradation during senescence following harvest and spore diffusion. TLPs are three-domain, crescent-fold structures with either an electronegative, electropositive, or neutral cleft occurring between domains I and II. TLG1 from Lentinula edodes contains the required acidic amino acids conserved in the appropriate positions to possess an electronegative cleft. TLPs within this subfamily contain 13 conserved Cys residues; the number of total Cys residues in these TLPs varies from 16 in L. edodes TLG1 to 18 in other basidiomycete homologs.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPH74560.1|GH152	5.16e-16	65	283	9	231
UPH74559.1|GH152	5.16e-16	65	283	9	231
AIU34431.1|GH152	1.32e-15	83	283	19	215
QCD98733.1|GH152	2.08e-14	180	283	128	236
QHO46107.1|GH152	2.50e-14	94	290	50	245

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3ZS3_A	7.87e-09	176	293	100	220	High resolution structure of Mal d 2, the thaumatin like food allergen from apple [Malus domestica]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P28493|PR5_ARATH	5.48e-12	115	283	68	228	Pathogenesis-related protein 5 OS=Arabidopsis thaliana OX=3702 GN=At1g75040 PE=1 SV=1
sp|P81295|PRR3_JUNAS	7.15e-11	179	276	117	207	Pathogenesis-related 5 protein Jun a 3.0101 OS=Juniperus ashei OX=13101 PE=1 SV=1
sp|Q4W6C7|CRJ37_CRYJA	7.76e-11	102	283	53	218	Pathogenesis-related thaumatin-like protein 3.7 OS=Cryptomeria japonica OX=3369 PE=1 SV=1
sp|Q9FY35|PRR3_HESAR	1.22e-10	179	276	91	181	Pathogenesis-related 5 protein Cup a 3 (Fragment) OS=Hesperocyparis arizonica OX=49011 PE=1 SV=1
sp|A4PBQ1|CRJ38_CRYJA	5.07e-09	179	276	117	207	Pathogenesis-related thaumatin-like protein 3.8 OS=Cryptomeria japonica OX=3369 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.001235	0.998766	CS pos: 19-20. Pr: 0.5284

TMHMM  Annotations     

There is no transmembrane helices in Bcin16g04140.2:RNA-p1.