CAZyme Information: Bcin16g00005.1:RNA-p1

Basic Information

• Species: Botrytis cinerea
• Lineage: Ascomycota; Leotiomycetes; ; Sclerotiniaceae; Botrytis; Botrytis cinerea
• CAZyme ID: Bcin16g00005.1:RNA-p1
• CAZy Family: GT57
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
830	bcin_chr_16|CGC2	90707.05	7.8592

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_BcinereaB05-10	12073	332648	366	11707

• Gene Location: location=bcin_chr_16:19965-22672(-)

Full Sequence      

MADSKLYEQEHNQADSPPSYGEATLSDTLLFSQTTKARDDGRIDLDLTSNVARRLSKYLD
IPSYTDFDTKLPEIRENRPWAVKLNIVIQVVGSRGDVQPFIALGNELQKHGHRVRIATYD
QFEDFVRQANLEFYPIGGNPAELMAFMVKNPGLIPSMQTLRSGEIQRKRATISEMLEGCW
RSCFKPDMISAEPFVADAIIANPPSFAHVHCAQALGIPLHLCFTMPWSPTAAFPHPLANI
KTSSVDVGTGNYLSYLLVEWMTWQGLGDIINSFRERIDLEHVPYSEGPTLAVSLKIPFTY
CWSPALVPRPIDWPPHIDVCGFFFRDTPVYTPPPELDAFLRMRGPPVVYIGFGSIVIDDP
EALTGTLLDAVHALGVRAIISKGWSKLGGADFEDIFYLDDCPHEWLFQHVSAVVHHGGAG
TTACGLSNGRPTMVVPFFGDQPFWGEMINAAGAGPTPVPFKSLNTKNLVEGLKFCLTKEA
AIAAGKIASKMVKEDGVKAAVRSFHANLPLEDLRCDLLPDKPAAWRYKHKEKTIKLSKFA
MQILLENNRLDQENVKLLETKHIDILHRRWDPVTAMASAYIGIATDIVQAQVGVFTKPYE
EYKKAQAQNKSRKIVDESLSKQDPEVSDSHSLPGGNGAMSSSSSIHSTNSHNKKSGTAGL
MARASGKSAGKMFVATGKGFFVNVPLAMADGMRAMPGFYGDKAKDCGNVTGWKSGMAAGG
KAFSYGIVGGLADLVVQPYKGGRKEGALGVAKGIGKGTLGMISKISGGAVGFYAYPAQGI
AKSISNTVHTTKKKEIQAAKREEGAWLIQEGRLTNEDVKVIIDVFEFIKI

Enzyme Prediction     

EC	2.4.1.173:23	2.4.1.-:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	134	503	1.6e-55	0.8952879581151832

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340817	GT1_Gtf-like	3.39e-82	84	506	1	403	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
224732	YjiC	7.55e-46	86	506	4	397	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
397255	Glyco_transf_28	9.84e-23	86	234	1	139	Glycosyltransferase family 28 N-terminal domain. The glycosyltransferase family 28 includes monogalactosyldiacylglycerol synthase (EC 2.4.1.46) and UDP-N-acetylglucosamine transferase (EC 2.4.1.-). This N-terminal domain contains the acceptor binding site and likely membrane association site. This family also contains a large number of proteins that probably have quite distinct activities.
273616	MGT	3.77e-11	95	454	7	336	glycosyltransferase, MGT family. This model describes the MGT (macroside glycosyltransferase) subfamily of the UDP-glucuronosyltransferase family. Members include a number of glucosyl transferases for macrolide antibiotic inactivation, but also include transferases of glucose-related sugars for macrolide antibiotic production. [Cellular processes, Toxin production and resistance]
227376	MRS6	3.30e-05	715	796	2344	2421	Vacuolar protein sorting-associated protein [Intracellular trafficking and secretion].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATZ58128.1|GT1	0.0	1	830	1	830
UPK92276.1|GT1	8.84e-313	36	826	67	854
CEI68149.1|GT1	1.25e-310	36	826	71	855
UPL02209.1|GT1	8.20e-308	15	825	29	839
QKD61343.1|GT1	5.69e-306	39	803	23	789

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XVM_A	2.38e-80	91	508	27	439	Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C],5XVM_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C]
5GL5_A	4.09e-80	91	508	47	459	Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C],5GL5_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C]
1IIR_A	1.46e-29	84	502	1	392	Crystal Structure of UDP-glucosyltransferase GtfB [Amycolatopsis orientalis]
3H4I_A	1.54e-26	84	502	1	375	Chimeric Glycosyltransferase for the generation of novel natural products [Amycolatopsis orientalis],3H4T_A Chimeric Glycosyltransferase for the generation of novel natural products - GtfAH1 in complex with UDP-2F-Glc [Amycolatopsis orientalis]
1RRV_A	3.69e-24	84	500	1	391	X-ray crystal structure of TDP-vancosaminyltransferase GtfD as a complex with TDP and the natural substrate, desvancosaminyl vancomycin. [Amycolatopsis orientalis],1RRV_B X-ray crystal structure of TDP-vancosaminyltransferase GtfD as a complex with TDP and the natural substrate, desvancosaminyl vancomycin. [Amycolatopsis orientalis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9XIG1|U80B1_ARATH	8.36e-127	83	511	155	577	Sterol 3-beta-glucosyltransferase UGT80B1 OS=Arabidopsis thaliana OX=3702 GN=UGT80B1 PE=1 SV=1
sp|Q9M8Z7|U80A2_ARATH	7.87e-123	84	509	193	611	Sterol 3-beta-glucosyltransferase UGT80A2 OS=Arabidopsis thaliana OX=3702 GN=UGT80A2 PE=1 SV=1
sp|Q8NJS1|ATG26_LEPMC	6.01e-82	1	508	880	1374	Sterol 3-beta-glucosyltransferase OS=Leptosphaeria maculans OX=5022 GN=ATG26 PE=3 SV=1
sp|Q6C8M8|ATG26_YARLI	2.27e-80	83	508	994	1413	Sterol 3-beta-glucosyltransferase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=ATG26 PE=3 SV=3
sp|Q0UY53|ATG26_PHANO	2.08e-78	1	508	876	1370	Sterol 3-beta-glucosyltransferase OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) OX=321614 GN=ATG26 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000044	0.000000

TMHMM  Annotations     

There is no transmembrane helices in Bcin16g00005.1:RNA-p1.