CAZyme Information: Bcin15g01170.1:RNA-p1

Basic Information

• Species: Botrytis cinerea
• Lineage: Ascomycota; Leotiomycetes; ; Sclerotiniaceae; Botrytis; Botrytis cinerea
• CAZyme ID: Bcin15g01170.1:RNA-p1
• CAZy Family: GT31
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
845		89557.47	6.4434

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_BcinereaB05-10	12073	332648	366	11707

• Gene Location: location=bcin_chr_15:448029-451197(-)

Full Sequence      

MRLTGLLYGIIALASYAVREVSTQDFAAHGYYTEPNTGITFYTSTEVNGTIVGDGEFSLV
SLGGYTFGMALPPSALTTDSYDYIGLIIGSLPNGTGWSGVVHGQQLSAAMPGHLLLIAWP
YNGQIITSFRYGSYATPVLYGGSASVTQLYSSINSTHWVLVYKCTNCFKFDDPTQTAYNV
STSAGGFEYGWAQNIGAPDNPSDPANAVLYQHNNGMGEFSIKVASATQSSYSKWASMTAT
ITATTGTATATATYSTSPIPTSTSYDYIVVGGGAGGVPMADKLAQSGKSVLLIEKGVASS
ARWGGTIRPESGWLAGSNLTWFDVPGECNRIWHGGSVGVACDDIDQMAGCVLGGGTAVNA
GLWWNPDPSDWDYNFPPGWQSKDVAAATSRVFSTIPGTDHPSMDGKLYLQSGYNIVAGGL
KNAGWTNVTANSVPAQKNRTFAYTPYMYINGERGGPLATYLVDANKRSNFHMWLNTSVKR
IIRDGGHATGIEVEATNNGGRQGVVSLTSVTGRVIVSAGAFGTPKLLFRSGIGPTDQLNV
VLTSTDGPTMINSSYWYNLPVGYNLDDHLNTDVQISHPNISYYDWVEAWNTPISADATSY
LTKRTGPLAQAAPDIGPMFWEQITPGDGIPRAIQWTARVEGDVSTAMTLSSYLGRGQVGP
RGRTTISKGLTMSVSTMPWGNTYDLAAVATAIDHLVTALSTVKNLTFIYPKPGMTGTQYV
ASVPLTYANIGARRANHWLGTAKLGTDSGLAGGTSVVDLNALVYGTDNIHVVDASIFPGM
PSTNPSSLIVIAAEHASQKILALPALKALPRYAQCGGLSFNYTTGGSCAAPYKCTVGNSY
YWQCL

Enzyme Prediction     

EC	1.1.99.18:13	1.1.99.18:13

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	253	803	1e-211	0.9835766423357665
AA8	32	234	2.5e-54	0.9945054945054945

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
406418	CDH-cyt	6.14e-53	32	230	1	177	Cytochrome domain of cellobiose dehydrogenase. CDH-cyt is the cytochrome domain, at the N-terminus, of cellobiose dehydrogenase. CDH-cyt folds as a beta sandwich with the topology of the antibody Fab V(H) domain and binds iron. The haem iron is ligated by Met83 and His181 in UniProtKB:Q01738.
225186	BetA	1.18e-33	279	806	22	539	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
187688	CDH_like_cytochrome	3.04e-33	32	221	2	166	Heme-binding cytochrome domain of fungal cellobiose dehydrogenases. Cellobiose dehydrogenase (CellobioseDH or CDH) is an extracellular fungal oxidoreductase that degrades both lignin and cellulose. Specifically, CDHs oxidize cellobiose, cellodextrins, and lactose to corresponding lactones, utilizing a variety of electron acceptors. Class-II CDHs are monomeric hemoflavoenzymes that are comprised of a b-type cytochrome domain linked to a large flavodehydrogenase domain. The cytochrome domain of CDH and related enzymes, which this model describes, folds as a beta sandwich and complexes a heme molecule. It is found at the N-terminus of this family of enzymes, and belongs to the DOMON domain superfamily, a ligand-interacting motif found in all three kingdoms of life.
398739	GMC_oxred_C	1.02e-16	660	796	3	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	5.75e-16	348	569	23	217	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATZ57550.1|AA3_1|AA8|CBM1	0.0	1	845	1	845
CCD47495.2|AA3_1|AA8|CBM1	0.0	1	845	1	847
APA13507.1|AA3_1|AA8|CBM1	0.0	1	845	1	845
QSZ32900.1|AA3_1|AA8|CBM1	0.0	17	845	20	827
QKX62083.1|AA3_1|AA8	5.42e-292	32	843	188	984

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4QI7_A	2.74e-285	32	845	7	806	Cellobiose dehydrogenase from Neurospora crassa, NcCDH [Neurospora crassa OR74A],4QI7_B Cellobiose dehydrogenase from Neurospora crassa, NcCDH [Neurospora crassa OR74A]
4QI6_A	9.05e-279	32	845	8	807	Chain A, Cellobiose dehydrogenase [Thermothelomyces myriococcoides]
4QI4_A	1.31e-233	268	845	11	585	Chain A, Cellobiose dehydrogenase [Thermothelomyces myriococcoides],4QI5_A Chain A, Cellobiose dehydrogenase [Thermothelomyces myriococcoides]
1NAA_A	1.95e-104	268	803	6	537	Chain A, Cellobiose dehydrogenase [Phanerodontia chrysosporium],1NAA_B Chain B, Cellobiose dehydrogenase [Phanerodontia chrysosporium]
1KDG_A	2.25e-104	268	803	11	542	Chain A, cellobiose dehydrogenase [Phanerodontia chrysosporium],1KDG_B Chain B, cellobiose dehydrogenase [Phanerodontia chrysosporium]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q01738|CDH_PHACH	5.90e-123	32	803	24	769	Cellobiose dehydrogenase OS=Phanerodontia chrysosporium OX=2822231 GN=CDH-1 PE=1 SV=1
sp|Q47944|SDH_GLUOY	8.70e-18	268	800	8	527	L-sorbose 1-dehydrogenase OS=Gluconobacter oxydans OX=442 PE=3 SV=1
sp|P0DO29|ERIK_HERER	1.36e-16	268	800	37	595	Dehydrogenase eriK OS=Hericium erinaceus OX=91752 GN=eriK PE=3 SV=1
sp|B3PTE0|BETA_RHIE6	1.10e-15	268	586	6	310	Oxygen-dependent choline dehydrogenase OS=Rhizobium etli (strain CIAT 652) OX=491916 GN=betA PE=3 SV=1
sp|B5ZUG2|BETA_RHILW	9.56e-14	268	586	6	310	Oxygen-dependent choline dehydrogenase OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) OX=395492 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000469	0.999515	CS pos: 19-20. Pr: 0.9504

TMHMM  Annotations     

There is no transmembrane helices in Bcin15g01170.1:RNA-p1.