CAZyme Information: Bcin14g03800.1:RNA-p1

Basic Information

• Species: Botrytis cinerea
• Lineage: Ascomycota; Leotiomycetes; ; Sclerotiniaceae; Botrytis; Botrytis cinerea
• CAZyme ID: Bcin14g03800.1:RNA-p1
• CAZy Family: GT22
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
309	bcin_chr_14|CGC1	34915.99	9.5884

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_BcinereaB05-10	12073	332648	366	11707

• Gene Location: location=bcin_chr_14:1467551-1468607(-)

Full Sequence      

MHLAYPSRKASNPPAYFAPRSSRFPMLRRSRAKTIVLGACAIGVVFFILSRILGGANGVP
SGTPPVVIVTVLDTVGYSKEYQDSVKENRIQYARKHGYTTFFPSIGDYDIQGSPNSWSKV
PAARHALSKFPHSEYIWVLEQNALIMNPALKVEDHIMAPKRLESLMVKDQSIVPPDSVIK
TFPNLKGENVDLVLTQDKDGLSQASFIIRRGEWSKFFLDTWFDPLYRSYNFQKADLHALE
HIVQWHPTILSKLALVPQKIMNAYSSDEAEGYKDGDFVVRLPGCDQSGRDCGKEAEKYTR
QWRTVFASR

Enzyme Prediction     

No EC number prediction in Bcin14g03800.1:RNA-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT34	64	292	1.7e-75	0.983739837398374

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
368535	Glyco_transf_34	1.22e-87	62	291	1	238	galactosyl transferase GMA12/MNN10 family. This family contains a number of glycosyltransferase enzymes that contain a DXD motif. This family includes a number of C. elegans homologs where the DXD is replaced by DXH. Some members of this family are included in glycosyltransferase family 34.
215616	PLN03181	2.60e-06	88	221	156	266	glycosyltransferase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATZ57222.1|GT34	1.45e-230	1	309	1	309
APA16197.1|GT34	1.08e-216	1	309	1	309
QSZ33097.1|GT34	3.15e-202	1	309	1	308
VCU39709.1|GT34	1.04e-131	1	308	1	311
VBB77835.1|GT34	8.62e-129	1	306	1	310

PDB Hits     

Bcin14g03800.1:RNA-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O13640|YGWH_SCHPO	7.84e-40	78	301	85	309	Uncharacterized alpha-1,2-galactosyltransferase C8D2.17 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pi048 PE=3 SV=2
sp|O94622|YBKD_SCHPO	6.10e-38	81	298	123	346	Uncharacterized alpha-1,2-galactosyltransferase C1289.13c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1289.13c PE=3 SV=1
sp|Q09174|GMA12_SCHPO	6.65e-35	81	298	123	346	Alpha-1,2-galactosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gma12 PE=1 SV=1
sp|Q10359|GMH3_SCHPO	3.08e-33	87	284	113	314	Alpha-1,2-galactosyltransferase gmh3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gmh3 PE=3 SV=1
sp|P50108|MNN10_YEAST	1.25e-29	87	306	151	390	Probable alpha-1,6-mannosyltransferase MNN10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNN10 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999915	0.000096

TMHMM  Annotations     

Start	End
35	54