CAZyme Information: Bcin14g02430.2:RNA-p1

Basic Information

• Species: Botrytis cinerea
• Lineage: Ascomycota; Leotiomycetes; ; Sclerotiniaceae; Botrytis; Botrytis cinerea
• CAZyme ID: Bcin14g02430.2:RNA-p1
• CAZy Family: GT20
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
517		57484.80	6.8640

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_BcinereaB05-10	12073	332648	366	11707

• Gene Location: location=bcin_chr_14:953329-955130(+)

Full Sequence      

MRYCDNRPSGVIRGEVLGGTSRINSMIYTRSTAADYDAWASLGYSEWSYKKLLPYFVKSE
TSLDYQNSTYHGNTGPWITQTFNYFSWLFQAYRAFTDCAKAMDFIAVPDFNAPDAPPEGV
TTLSLTLSRQRERVSSFEAFLPKKIALERRNLTICTNALVSRIVFTEEKGLPHTEKILFK
SSDQKSDNIYSVKINKEVIVCSGAVGSPQVLMLSGIGPRECLEEHGIKVVHDLPGVGSTL
TDHHSIPVAWEVPAAESLTSMATSPLKIALELFKYIFFQVGLFSIPVQTLALYVRSRMTK
EDSTGLVEEVSPKSFDPQSLIPDIELMPLSTSGMDNFDDPEFKNILSKTPIFCVLATILQ
PKSHGTVRLASSNPHDKPKVDFGILSDDSDYTIARSAVRLTLFIADKIKASGFPLLRNLT
FPAEKQELDAQNNTTEEMDKFIRKRIRTTFHYASTCRMAPEYDSKAPGVVDDELKVHGVK
GLRVCDTSIFPKIVSGHLQAPAVMVAEKCADLIKNGP

Enzyme Prediction     

No EC number prediction in Bcin14g02430.2:RNA-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	4	515	3.4e-128	0.875

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	1.81e-93	13	514	84	532	choline dehydrogenase; Validated
225186	BetA	5.63e-89	1	515	71	535	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	1.18e-41	361	509	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	2.03e-27	4	243	14	216	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	6.00e-22	150	505	233	568	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATZ57062.1|AA3_2	0.0	1	517	1	517
ATZ57063.1|AA3_2	0.0	1	517	1	517
ATZ51574.1|AA3_2	2.23e-227	1	514	86	599
APA09342.1|AA3_2	6.55e-184	1	513	91	617
APA07526.1|AA3_2	8.75e-173	102	515	1	364

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ZH7_A	2.01e-50	13	513	83	560	Chain A, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis],6ZH7_B Chain B, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
6YRU_AAA	2.01e-50	13	513	83	560	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRV_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRX_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRZ_AAA Chain AAA, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
6YS1_AAA	2.01e-50	13	513	83	560	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]
6YS2_AAA	2.01e-50	13	513	83	560	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]
5NCC_A	2.58e-50	13	513	99	576	Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_B Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_C Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_D Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_E Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_F Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q47944|SDH_GLUOY	4.20e-63	1	514	68	528	L-sorbose 1-dehydrogenase OS=Gluconobacter oxydans OX=442 PE=3 SV=1
sp|A0A3B1EFP9|STR4_STRTC	3.22e-59	1	514	100	612	Dehydrogenase str4 OS=Strobilurus tenacellus OX=41251 GN=str4 PE=1 SV=1
sp|Q988C9|4PADH_RHILO	4.28e-59	13	513	83	533	4-pyridoxate dehydrogenase OS=Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099) OX=266835 GN=padh1 PE=1 SV=1
sp|Q6LGH5|BETA_PHOPR	5.04e-59	5	513	73	530	Oxygen-dependent choline dehydrogenase OS=Photobacterium profundum (strain SS9) OX=298386 GN=betA PE=3 SV=1
sp|C3K3D3|BETA_PSEFS	3.60e-57	3	514	73	534	Oxygen-dependent choline dehydrogenase OS=Pseudomonas fluorescens (strain SBW25) OX=216595 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999978	0.000072

TMHMM  Annotations     

There is no transmembrane helices in Bcin14g02430.2:RNA-p1.