CAZyme Information: Bcin14g00860.1:RNA-p1

Basic Information

• Species: Botrytis cinerea
• Lineage: Ascomycota; Leotiomycetes; ; Sclerotiniaceae; Botrytis; Botrytis cinerea
• CAZyme ID: Bcin14g00860.1:RNA-p1
• CAZy Family: GT2
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
327		34512.05	6.4636

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_BcinereaB05-10	12073	332648	366	11707

• Gene Location: location=bcin_chr_14:375410-376449(+)

Full Sequence      

MRVLLTLSSFVAAVLATARTSAPSGAITAGSGGKYSTFQKAVNALSTTTTSAQVIFLYSG
TYSEQVTIPALKGKLTVYGYTKDTSSYEDNVVNIVHSSSLLSGAANDEETGTVINLSENT
AFYNINIKNTYGKGSQAIALAAYNTEQGYYGVGLYGYQDTLLTQTGNQVYAKCYIEGAVD
WIFGQHSVAWIDGSTIAASAGGGCITANGRATSSDPSFYVINKCTVTTSSSSTAGSKSVY
LGRPWTQYARVAYQETSLGSIIESAGWSQWSTSDARTGNVLFEEYDNTGTGASGTRASFS
KKYSTAYTIAGVLGSSYSKWVDTSYLS

Enzyme Prediction     

EC	3.1.1.11:8

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	31	304	3.2e-68	0.9201388888888888

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
178372	PLN02773	5.42e-29	30	292	13	270	pectinesterase
178051	PLN02432	4.22e-28	33	306	21	275	putative pectinesterase
215357	PLN02665	4.47e-28	32	304	77	341	pectinesterase family protein
178113	PLN02497	5.85e-26	33	306	42	309	probable pectinesterase
215170	PLN02301	2.72e-25	33	321	246	548	pectinesterase/pectinesterase inhibitor

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATZ56871.1|CE8	1.28e-224	1	327	1	327
CCD50540.1|CE8	1.28e-224	1	327	1	327
APA16046.1|CE8	3.45e-190	1	327	1	327
QSZ32978.1|CE8	1.84e-171	1	327	1	327
ARB08121.1|CE8	2.31e-113	12	327	14	331

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5C1E_A	3.70e-68	19	325	3	299	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
5C1C_A	5.22e-68	19	325	3	299	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
1GQ8_A	1.75e-23	20	293	4	274	Pectin methylesterase from Carrot [Daucus carota]
1XG2_A	1.75e-19	33	292	13	269	Chain A, Pectinesterase 1 [Solanum lycopersicum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P17872|PME_ASPNG	3.05e-101	10	327	11	331	Pectinesterase OS=Aspergillus niger OX=5061 GN=pme1 PE=1 SV=1
sp|Q12535|PME_ASPAC	3.24e-98	10	325	11	330	Pectinesterase OS=Aspergillus aculeatus OX=5053 GN=pme1 PE=2 SV=1
sp|A2QK82|PMEA_ASPNC	7.73e-68	19	325	31	327	Probable pectinesterase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=pmeA PE=3 SV=1
sp|Q4WBT5|PMEA_ASPFU	1.12e-66	19	325	28	324	Probable pectinesterase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=pmeA PE=3 SV=1
sp|B0Y9F9|PMEA_ASPFC	1.12e-66	19	325	28	324	Probable pectinesterase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=pmeA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000246	0.999729	CS pos: 16-17. Pr: 0.9786

TMHMM  Annotations     

There is no transmembrane helices in Bcin14g00860.1:RNA-p1.