CAZyme Information: Bcin14g00610.5:RNA-p1

Basic Information

• Species: Botrytis cinerea
• Lineage: Ascomycota; Leotiomycetes; ; Sclerotiniaceae; Botrytis; Botrytis cinerea
• CAZyme ID: Bcin14g00610.5:RNA-p1
• CAZy Family: GT2
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
411		42310.81	8.4957

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_BcinereaB05-10	12073	332648	366	11707

• Gene Location: location=bcin_chr_14:247770-249222(-)

Full Sequence      

MKDHLRMRNTSMWELKFFYNTVFPIHFTRLHSLCSLKMVHITSLISFLASTALVSAAPGS
APADLDRRAGCTFSTAATAIASKTTCSTIILDSVVVPAGTTLDLTGLKTGTKVIFQGTAT
FGYSEWEGPLISISGQDIVVTGASGNKIDGGGARWWDGLGSNVSAGKGKVKPKFFSAHKL
TGSSSITGLNFLNAPVQCISIGQSVGLSLININIDNSAGDAGNLGHNTDAFDINLSQNIF
ISGAIVKNQDDCVAVNSGTNITFTGGNCSGGHGLSIGSVGGRSGTGANDVKDVRFLSSTV
QKSTNGVRVKTVSDTKGSVTGVTFQDITLIGITGVGIDVQQDYQNGSPTGTPTNGVPITG
LTMNNVHGNVIGGQNTYILCANCSGWTWNKVAVTGGTVKKACAGVPTGASC

Enzyme Prediction     

EC	3.2.1.15:80

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH28	81	411	5.7e-62	0.9661538461538461

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395231	Glyco_hydro_28	5.87e-114	86	411	1	321	Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes are important in cell wall metabolism.
215540	PLN03010	6.18e-24	126	396	124	371	polygalacturonase
227721	Pgu1	2.33e-21	45	332	69	398	Polygalacturonase [Carbohydrate transport and metabolism].
177865	PLN02218	6.11e-21	41	405	51	420	polygalacturonase ADPG
178580	PLN03003	2.19e-19	70	329	35	288	Probable polygalacturonase At3g15720

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATZ56839.1|GH28	7.15e-294	1	411	1	411
ATZ56838.1|GH28	9.89e-276	21	411	12	402
ATZ56841.1|GH28	1.08e-263	38	411	1	374
CCD50501.1|GH28	1.08e-263	38	411	1	374
ATZ56842.1|GH28	1.08e-263	38	411	1	374

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6KVE_A	1.27e-133	61	411	1	344	Chain A, Endo-polygalacturonase [Evansstolkia leycettana]
6KVH_A	7.29e-133	61	411	1	344	Chain A, endo-polygalacturonase [Evansstolkia leycettana]
2IQ7_A	4.98e-132	69	408	1	334	Crystal structure of the polygalacturonase from Colletotrichum lupini and its implications for the interaction with polygalacturonase-inhibiting proteins [Colletotrichum lupini],2IQ7_B Crystal structure of the polygalacturonase from Colletotrichum lupini and its implications for the interaction with polygalacturonase-inhibiting proteins [Colletotrichum lupini],2IQ7_C Crystal structure of the polygalacturonase from Colletotrichum lupini and its implications for the interaction with polygalacturonase-inhibiting proteins [Colletotrichum lupini],2IQ7_D Crystal structure of the polygalacturonase from Colletotrichum lupini and its implications for the interaction with polygalacturonase-inhibiting proteins [Colletotrichum lupini],2IQ7_E Crystal structure of the polygalacturonase from Colletotrichum lupini and its implications for the interaction with polygalacturonase-inhibiting proteins [Colletotrichum lupini],2IQ7_F Crystal structure of the polygalacturonase from Colletotrichum lupini and its implications for the interaction with polygalacturonase-inhibiting proteins [Colletotrichum lupini],2IQ7_G Crystal structure of the polygalacturonase from Colletotrichum lupini and its implications for the interaction with polygalacturonase-inhibiting proteins [Colletotrichum lupini]
7E56_A	1.47e-130	69	411	1	336	Chain A, Endo-polygalacturonase [Evansstolkia leycettana]
1IA5_A	3.97e-121	71	411	4	339	Polygalacturonase From Aspergillus Aculeatus [Aspergillus aculeatus],1IB4_A Crystal Structure of Polygalacturonase from Aspergillus Aculeatus at Ph4.5 [Aspergillus aculeatus],1IB4_B Crystal Structure of Polygalacturonase from Aspergillus Aculeatus at Ph4.5 [Aspergillus aculeatus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q12708|PGLR1_SCLSC	9.06e-142	38	411	1	380	Endo-polygalacturonase OS=Sclerotinia sclerotiorum OX=5180 GN=PG1 PE=3 SV=1
sp|O93883|PGLR_PENGR	2.24e-131	44	411	9	376	Polygalacturonase OS=Penicillium griseoroseum OX=84562 GN=PGG1 PE=3 SV=1
sp|P26215|PGLR_COCCA	1.12e-128	48	411	11	364	Polygalacturonase OS=Cochliobolus carbonum OX=5017 GN=PGN1 PE=3 SV=1
sp|Q00446|PGLR1_COLLN	8.80e-128	38	408	1	358	Endopolygalacturonase 1 OS=Colletotrichum lindemuthianum OX=290576 GN=PG1 PE=3 SV=1
sp|P49575|PGLRA_ASPPA	8.17e-126	42	411	6	363	Probable endopolygalacturonase A OS=Aspergillus parasiticus OX=5067 GN=pgaA PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.792804	0.207181

TMHMM  Annotations     

There is no transmembrane helices in Bcin14g00610.5:RNA-p1.