CAZyme Information: Bcin14g00480.1:RNA-p1

Basic Information

• Species: Botrytis cinerea
• Lineage: Ascomycota; Leotiomycetes; ; Sclerotiniaceae; Botrytis; Botrytis cinerea
• CAZyme ID: Bcin14g00480.1:RNA-p1
• CAZy Family: GT2
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
833		91483.93	5.1508

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_BcinereaB05-10	12073	332648	366	11707

• Gene Location: location=bcin_chr_14:184247-186907(+)

Full Sequence      

MTNRFDVEDVLSKLNNVEKVSLLAGTDWWHTAAIPKHNVPSIRVSDGPNGVRGTRFFNGI
TAACFPCGTALAATWDTKLLHRAGVLMGEEAKAKGVHVILGPTINMQRSPLGGRGFESFS
EDPVLSGLGAAALVNGIQETGVQATIKHFVCNDQEHNRNGVNVIITERALREIYLLPFQL
VVRDSKPALFMSAYNKINGTHVSENPKILKDILRGEWGWSGCVMSDWWGTYSTTGAINAG
LDLEMPGSTKWRGPMLIQAVSTGKVPQHILDERARNVLNAVNRAADANVPENAEEKTADT
PETAALLREIAGDSIVLMKNEGSVLPFRKDKKTFIVGPNAKVATFHGGGSASLAAYYAVT
PFDGISQQLESAPTYTVGAYAHKDLPLLDSALKTDKGERGISFRAYNEPPTAEDREIADE
IILTKTELLMMDYYCSKLKNELWWADVEGYMTAEEDCDFEFGLGVYGTANLYVDGKLIID
NTTKQTRGTMFFSCGTVEERGVVSLKKGQTYHLKIEFASSPTCKLDKGNNVLFGPGAIRL
GGAKIIDADEEIARAAELAKEADQVIICAGLNSDWEGEGADREIFGLPLHMNKLISTLTP
LNPNTVVVIQSGTPVDLPFLSTTPALLQAWYGGNETGNAIADVIFGKTNPSAKLPLSFPK
RIEDNPAFLSFRSERGRVIYGEDIYMGYRWYDALNLPVLFPFGHGLSYTTFAISDLNIEK
SDKKIKISVKVKNTGEVSGAEVVQVYIQQQNPSIRRPNKELKGFEKVFLKAGEEKRVEVD
IEVKYAAAFWDEVREAWVVEKDAYDVLVGNTSELAGELKATFEVERTEWWNGL

Enzyme Prediction     

EC	3.2.1.21:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	32	246	1.4e-66	0.9907407407407407

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224389	BglX	1.71e-72	15	373	38	387	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
185053	PRK15098	3.21e-72	65	809	120	751	beta-glucosidase BglX.
396478	Glyco_hydro_3_C	3.67e-49	315	708	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
395747	Glyco_hydro_3	3.93e-41	52	280	78	316	Glycosyl hydrolase family 3 N terminal domain.
178629	PLN03080	1.32e-29	10	782	56	743	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCD50485.1|GH3	0.0	1	833	1	833
ATZ56815.1|GH3	0.0	1	833	1	833
APA07494.1|GH3	0.0	1	833	1	834
QSZ32943.1|GH3	0.0	1	833	1	834
UQC84651.1|GH3	0.0	5	833	4	833

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	1.95e-271	3	833	2	845	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	1.89e-266	3	833	2	845	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	1.12e-140	6	812	4	657	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	6.08e-120	18	812	16	652	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	6.11e-105	7	824	4	713	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q0CAF5|BGLI_ASPTN	0.0	4	833	3	839	Probable beta-glucosidase I OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=bglI PE=3 SV=1
sp|B0Y3M6|BGLI_ASPFC	0.0	4	833	3	838	Probable beta-glucosidase I OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglI PE=3 SV=1
sp|Q5BB53|BGLI_EMENI	0.0	4	833	3	839	Probable beta-glucosidase I OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglI PE=2 SV=2
sp|B8NDE2|BGLI_ASPFN	0.0	4	833	3	839	Probable beta-glucosidase I OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=bglI PE=3 SV=2
sp|Q2U8Y5|BGLI_ASPOR	0.0	4	833	3	839	Probable beta-glucosidase I OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999578	0.000439

TMHMM  Annotations     

There is no transmembrane helices in Bcin14g00480.1:RNA-p1.