CAZyme Information: Bcin13g03680.1:RNA-p1

Basic Information

• Species: Botrytis cinerea
• Lineage: Ascomycota; Leotiomycetes; ; Sclerotiniaceae; Botrytis; Botrytis cinerea
• CAZyme ID: Bcin13g03680.1:RNA-p1
• CAZy Family: GT1
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
537		57902.46	4.2509

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_BcinereaB05-10	12073	332648	366	11707

• Gene Location: location=bcin_chr_13:1279910-1281590(-)

Full Sequence      

MKGSSLISLGLLPVLSVNAAYTWPSEYDQLEDILYLQQGFIRFGLRDGVTPCSFSSDGGG
RQAAAEWIRTAYHDMATHDVDTGLGGLDGSIAFELGRAENPGDAFNSTFAFTENLRSIRA
SSSDLLAMSVVVATMACGGPIIPFRGGRIDAMKAGVSGVPEPDQDLATHTAIFAKQGFNT
AEMITMVACGHTLGGVHGVDFPQITGNGDAENFPKFDSTYTAFDNTVVTEYLGNNSTDPL
VISKNDTFNSDKRIFGADNNKTMTSLADPTNFQKQCSDIFARMIDTVPADVTLSEVITPI
EVKPSQIALTLAGNNTLSFGGYIRLRTTNRNADDVTVSLQYRDRNNNTSNTTIPVSRENY
LLGQSYGFGSEVFTWYGFNTVLDAKTGISSFDVILHTVGAADEIITNNGGGFPLTDAILY
QPAQSCQPQISVNDAGQWNITVTAAVRADRINEPVAFDWVSQRTIPGAMVKALEVQRTAM
EKVSEEIDGYYLFSGTRSLDNVQWSTTFDVVLGEGDDVSKVEFQSTSAMATSCEAFS

Enzyme Prediction     

No EC number prediction in Bcin13g03680.1:RNA-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA2	61	243	5.6e-24	0.6941176470588235

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
173829	plant_peroxidase_like_1	1.83e-136	23	285	1	264	Uncharacterized family of plant peroxidase-like proteins. This is a subgroup of heme-dependent peroxidases similar to plant peroxidases. Along with animal peroxidases, these enzymes belong to a group of peroxidases containing a heme prosthetic group (ferriprotoporphyrin IX) which catalyzes a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. The plant peroxidase-like superfamily is found in all three kingdoms of life and carries out a variety of biosynthetic and degradative functions.
173823	plant_peroxidase_like	3.45e-24	55	284	9	254	Heme-dependent peroxidases similar to plant peroxidases. Along with animal peroxidases, these enzymes belong to a group of peroxidases containing a heme prosthetic group (ferriprotoporphyrin IX), which catalyzes a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. The plant peroxidase-like superfamily is found in all three kingdoms of life and carries out a variety of biosynthetic and degradative functions. Several sub-families can be identified. Class I includes intracellular peroxidases present in fungi, plants, archaea and bacteria, called catalase-peroxidases, that can exhibit both catalase and broad-spectrum peroxidase activities depending on the steady-state concentration of hydrogen peroxide. Catalase-peroxidases are typically comprised of two homologous domains that probably arose via a single gene duplication event. Class II includes ligninase and other extracellular fungal peroxidases, while class III is comprised of classic extracellular plant peroxidases, like horseradish peroxidase.
395089	peroxidase	2.77e-17	61	197	13	155	Peroxidase.
173825	ascorbate_peroxidase	7.80e-15	68	239	34	201	Ascorbate peroxidases and cytochrome C peroxidases. Ascorbate peroxidases are a subgroup of heme-dependent peroxidases of the plant superfamily that share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Along with related catalase-peroxidases, ascorbate peroxidases belong to class I of the plant superfamily. Ascorbate peroxidases are found in the chloroplasts and/or cytosol of algae and plants, where they have been shown to control the concentration of lethal hydrogen peroxide molecules. The yeast cytochrome c peroxidase is a divergent member of the family; it forms a complex with cytochrome c to catalyze the reduction of hydrogen peroxide to water.
173826	ligninase	2.88e-10	64	239	38	214	Ligninase and other manganese-dependent fungal peroxidases. Ligninases and related extracellular fungal peroxidases belong to class II of the plant heme-dependent peroxidase superfamily. All members of the superfamily share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Class II peroxidases are fungal glycoproteins that have been implicated in the oxidative breakdown of lignin, the main cell wall component of woody plants. They contain four conserved disulphide bridges and two conserved calcium binding sites.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD59397.1|AA0	1.23e-121	1	533	1	529
QGI68923.1|AA0	3.88e-120	1	533	1	529
QRV94524.1|AA2	4.41e-114	14	536	13	535
QRW22025.1|AA2	6.81e-114	7	536	5	538
QRV79935.1|AA2	1.38e-112	14	536	13	535

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5AMM_A	4.99e-06	68	232	30	191	Structure of Leishmania major peroxidase D211N mutant [Leishmania major],5AMM_B Structure of Leishmania major peroxidase D211N mutant [Leishmania major]
3RIW_A	5.02e-06	68	232	31	192	The Crystal Structure of Leishmania major Peroxidase mutant C197T [Leishmania major strain Friedlin],3RIW_B The Crystal Structure of Leishmania major Peroxidase mutant C197T [Leishmania major strain Friedlin]
4GED_A	6.58e-06	68	232	30	191	Crystal Structure of the Leishmania Major Peroxidase-Cytochrome C Complex [Leishmania major]
5AL9_A	6.67e-06	68	232	30	191	Structure of Leishmania major peroxidase D211R mutant (high res) [Leishmania major],5ALA_A Structure of Leishmania major peroxidase D211R mutant (low res) [Leishmania major],5ALA_B Structure of Leishmania major peroxidase D211R mutant (low res) [Leishmania major]
3RIV_A	6.71e-06	68	232	31	192	The Crystal Structure of Leishmania major Peroxidase [Leishmania major strain Friedlin],3RIV_B The Crystal Structure of Leishmania major Peroxidase [Leishmania major strain Friedlin]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4AUF4|WSCD2_ARTBC	6.05e-91	17	536	17	515	WSC domain-containing protein ARB_07870 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_07870 PE=1 SV=1
sp|Q8GY91|APX6_ARATH	8.54e-10	64	194	114	247	Putative L-ascorbate peroxidase 6 OS=Arabidopsis thaliana OX=3702 GN=APX6 PE=2 SV=1
sp|Q6ZJJ1|APX4_ORYSJ	2.10e-08	68	220	35	187	Probable L-ascorbate peroxidase 4, peroxisomal OS=Oryza sativa subsp. japonica OX=39947 GN=APX4 PE=2 SV=1
sp|A5H452|PER70_MAIZE	3.46e-08	63	296	50	313	Peroxidase 70 OS=Zea mays OX=4577 GN=PER70 PE=1 SV=1
sp|P0C0V3|CCPR_EMENI	4.25e-08	68	197	117	251	Cytochrome c peroxidase, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ccp1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000374	0.999582	CS pos: 19-20. Pr: 0.9764

TMHMM  Annotations     

There is no transmembrane helices in Bcin13g03680.1:RNA-p1.