CAZyme Information: Bcin13g03010.1:RNA-p1

Basic Information

• Species: Botrytis cinerea
• Lineage: Ascomycota; Leotiomycetes; ; Sclerotiniaceae; Botrytis; Botrytis cinerea
• CAZyme ID: Bcin13g03010.1:RNA-p1
• CAZy Family: GT1
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
841		94882.08	8.3274

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_BcinereaB05-10	12073	332648	366	11707

• Gene Location: location=bcin_chr_13:1060513-1063239(-)

Full Sequence      

MAGDATERPHRKSTLHEKRRAERRSRAVVAESEVPSEPTGSQTLSIDSLARLNDSIERAK
RREERKSRSRPPVKEDRGQSRERGSPSKDRRRKERGYATEDSSSPIKNRRRERDYDEIPG
SPIKERRRRNEYTDDESGSPRKDRRRQERGYTDDESGYRSKDKKLKDYSDYETAAETALR
IQKQRRKQNGIPEPKPKPKAKPNAPRKEERSLKIPNTYTDDETVYEKPRKEPKGKKRRVV
SGALLEEGEGELKQRRMFSGAGLKNDLRNLKGLRGGYAPTESSYPEKYIESDEDFRKRRK
RIWTGIGIGIVILIIIIAIAVSTSKKHTSSSSSSTAPATESGTPSNSNLDGMSESDIPVA
AQGTYLDPFTWYDTLDFNVTYTNETVGDLPVMGLNTSYSDDVAPNSNAPKISAKWGAYTS
RPARGVNLGGWLSIEPFITPSLFNSYSSADGIIDEWTLTTKLGASTAASTLEKHYATFVS
EKTFADIAAAGLDHVRIPYSYWAVITYDDDPYVFRTSWRYLLRGIEWARKYGLRINLDLH
ALPGSQNGWNHSGRQGTIGWLNGTNGDLNAQRSIEIHDRLSKFFAQDRYKNILSFYGLAN
EPRMTALDVNDVLNWTSTVTDMVVKNGISAYVVIGDGFRGLENWQGDLTSYDNLILDVHQ
YVIFNSGQILYNHTEKVNYACSGWTQQTEISMNKSTGFGPTMVAEWSQADTDCATYLTNV
NQGNRWEGTYDTGDSSTQQTTPDCPTQDSTCSCTNANADPSTYSDTYKNFLKMFAEAQMY
SFELGWGWFYWTWATETSEGGGTQWSYQRGLAAGILPKLAYDPDFKCSSTIPSFSSLPEY
Y

Enzyme Prediction     

EC	3.2.1.58:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	473	796	1.4e-100	0.9966996699669967

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225344	BglC	2.41e-46	410	836	5	403	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
395098	Cellulase	1.64e-09	475	661	20	195	Cellulase (glycosyl hydrolase family 5).
237171	PRK12678	4.07e-04	16	162	102	247	transcription termination factor Rho; Provisional
273721	SF-CC1	5.41e-04	76	176	18	111	splicing factor, CC1-like family. This model represents a subfamily of RNA splicing factors including the Pad-1 protein (N. crassa), CAPER (M. musculus) and CC1.3 (H.sapiens). These proteins are characterized by an N-terminal arginine-rich, low complexity domain followed by three (or in the case of 4 H. sapiens paralogs, two) RNA recognition domains (rrm: pfam00706). These splicing factors are closely related to the U2AF splicing factor family (TIGR01642). A homologous gene from Plasmodium falciparum was identified in the course of the analysis of that genome at TIGR and was included in the seed.
273721	SF-CC1	0.001	74	156	30	108	splicing factor, CC1-like family. This model represents a subfamily of RNA splicing factors including the Pad-1 protein (N. crassa), CAPER (M. musculus) and CC1.3 (H.sapiens). These proteins are characterized by an N-terminal arginine-rich, low complexity domain followed by three (or in the case of 4 H. sapiens paralogs, two) RNA recognition domains (rrm: pfam00706). These splicing factors are closely related to the U2AF splicing factor family (TIGR01642). A homologous gene from Plasmodium falciparum was identified in the course of the analysis of that genome at TIGR and was included in the seed.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATZ56465.1|GH5_9	0.0	1	841	1	841
CCD34874.1|GH5_9	0.0	1	841	1	826
APA15640.1|GH5_9	0.0	1	841	1	840
QSZ35967.1|GH5_9	0.0	1	841	1	840
VCU39406.1|GH5_9	3.58e-247	185	840	29	643

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1EQP_A	1.27e-62	418	825	4	387	Exo-b-(1,3)-glucanase From Candida Albicans [Candida albicans]
1CZ1_A	2.42e-62	418	825	4	387	Exo-b-(1,3)-glucanase From Candida Albicans At 1.85 A Resolution [Candida albicans],1EQC_A Exo-b-(1,3)-glucanase From Candida Albicans In Complex With Castanospermine At 1.85 A [Candida albicans]
2PB1_A	2.84e-62	418	825	10	393	Exo-B-(1,3)-Glucanase from Candida Albicans in complex with unhydrolysed and covalently linked 2,4-dinitrophenyl-2-deoxy-2-fluoro-B-D-glucopyranoside at 1.9 A [Candida albicans]
3O6A_A	5.28e-62	418	825	9	392	F144Y/F258Y Double Mutant of Exo-beta-1,3-glucanase from Candida albicans at 2 A [Candida albicans]
2PC8_A	7.49e-62	418	825	10	393	Chain A, Hypothetical protein XOG1 [Candida albicans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1CTI3|EXGD_ASPCL	1.15e-221	226	841	236	830	Probable glucan 1,3-beta-glucosidase D OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=exgD PE=3 SV=1
sp|B0Y7W2|EXGD_ASPFC	4.65e-216	236	841	248	833	Probable glucan 1,3-beta-glucosidase D OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=exgD PE=3 SV=1
sp|Q4WMP0|EXGD_ASPFU	4.65e-216	236	841	248	833	Probable glucan 1,3-beta-glucosidase D OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=exgD PE=3 SV=1
sp|A1DMX4|EXGD_NEOFI	1.92e-215	236	841	249	834	Probable glucan 1,3-beta-glucosidase D OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=exgD PE=3 SV=1
sp|A2QX52|EXGD_ASPNC	8.55e-213	345	841	343	830	Probable glucan 1,3-beta-glucosidase D OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=exgD PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000045	0.000000

TMHMM  Annotations     

Start	End
302	324