CAZyme Information: Bcin12g06630.1:RNA-p1

Basic Information

• Species: Botrytis cinerea
• Lineage: Ascomycota; Leotiomycetes; ; Sclerotiniaceae; Botrytis; Botrytis cinerea
• CAZyme ID: Bcin12g06630.1:RNA-p1
• CAZy Family: GH95
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
355		35267.79	4.3222

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_BcinereaB05-10	12073	332648	366	11707

• Gene Location: location=bcin_chr_12:2302068-2303211(+)

Full Sequence      

MQVPMKSLVALLPFFLQVSAQASGSGTTTRYWDCCKPSCAWSGKATLESGSGPVGTCDIN
DSPLSDPTAIAVSGCDGGNSYMCSDQSPWAVSDDLAYGYAAVNIAGGSEASWCCACYELT
FTSTALAGKKMIVQATNTGGDLGSNQFDLAIPGGGVGIFNGCTKEFGAPSSGWGAQYGGV
AAVSSCAAFPEALKPGCSFRFDWFEGADNPTVNFKQVNCPAELTKSTGCKRADDSSMPAP
DASGSASASPVASTSAKTSSVAPTSVSSSSVVVAPSSATSSPVVVVPTSAASSKASSAAV
VSHPVVPSSEASSAPAVTSHSSATKSAKTSVAAPHSTSASTGYGSGDDDDTCDAE

Enzyme Prediction     

EC	3.2.1.4:59

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH45	26	230	1.4e-88	0.9949494949494949

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
280233	Glyco_hydro_45	5.52e-77	25	230	1	214	Glycosyl hydrolase family 45.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCD33730.1|GH45	1.57e-200	1	355	1	355
ATZ56133.1|GH45	1.57e-200	1	355	1	355
APA13299.1|GH45	2.67e-157	1	244	1	244
QSZ34435.1|GH45	2.67e-140	1	241	1	240
QDS72490.1|CBM1|GH45	2.99e-112	14	238	17	236

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6MVI_A	1.30e-101	8	238	11	230	Apo Cel45A from Neurospora crassa OR74A [Neurospora crassa OR74A],6MVJ_A Cellobiose complex Cel45A from Neurospora crassa OR74A [Neurospora crassa OR74A]
5GLY_A	8.00e-101	22	238	1	209	Crystal structure of a glycoside hydrolase in complex with cellotetrose from Thielavia terrestris NRRL 8126 [Thermothielavioides terrestris NRRL 8126],5GM9_A Crystal structure of a glycoside hydrolase in complex with cellobiose [Thermothielavioides terrestris NRRL 8126]
5GLX_A	9.18e-101	22	238	4	212	Crystal structure of a glycoside hydrolase from Thielavia terrestris NRRL 8126 [Thermothielavioides terrestris NRRL 8126]
1HD5_A	5.59e-91	26	239	3	209	Endoglucanase from Humicola insolens AT 1.7A resolution [Humicola insolens]
2ENG_A	4.09e-90	26	239	3	209	Endoglucanase V [Humicola insolens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P45699|GUNK_FUSOX	4.11e-96	16	239	13	229	Putative endoglucanase type K OS=Fusarium oxysporum OX=5507 PE=2 SV=1
sp|P43316|GUN5_HUMIN	2.33e-89	26	239	3	209	Endoglucanase-5 OS=Humicola insolens OX=34413 PE=1 SV=1
sp|D3GDK4|GUN_CRYAT	2.74e-83	5	231	1	221	Endoglucanase OS=Cryptopygus antarcticus OX=187623 PE=1 SV=1
sp|O97401|GUN_PHACE	1.13e-61	13	229	27	240	Endoglucanase OS=Phaedon cochleariae OX=80249 PE=2 SV=1
sp|P18126|GUNB_CELJU	9.06e-51	25	232	268	501	Endoglucanase B OS=Cellvibrio japonicus (strain Ueda107) OX=498211 GN=celB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000194	0.999791	CS pos: 20-21. Pr: 0.9869

TMHMM  Annotations     

There is no transmembrane helices in Bcin12g06630.1:RNA-p1.