CAZyme Information: Bcin12g06590.1:RNA-p1

Basic Information

• Species: Botrytis cinerea
• Lineage: Ascomycota; Leotiomycetes; ; Sclerotiniaceae; Botrytis; Botrytis cinerea
• CAZyme ID: Bcin12g06590.1:RNA-p1
• CAZy Family: GH95
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
463	bcin_chr_12|CGC9	50703.30	5.1732

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_BcinereaB05-10	12073	332648	366	11707

• Gene Location: location=bcin_chr_12:2289883-2291332(-)

Full Sequence      

MRVTKGLFLAVAPLAVAAPTPSLFGDILALEAGIAKVVTTVVSTVKSDIQVAVSKIGATL
QTDASKHGSVWNYGNIPCPEVALSIQRYLHDIAWTKKSTNYVDWTTYKANGVNFGAWLEQ
EQNYDPDWWNAHAPDAIDEWGLCETLGAECGPVLEARYASWITTADIDKLAAQNINTLRI
PTTYAAWIKFPGSKLYHGNQQTYLRNIALYAIQKYGMHVIIGLHSLPGGVNSLGIGEAFG
HSGWFQNATNLDYSFKAIDAILTFIQSSGQPQGFTIAPINEASDNFEAFASSEGLTANGT
NWINTYINGVLTRVGKVNKKIPVMLQDCFLGETFWSPFYAAGMNLVIDSHIYFFAAAGIY
SQYVSPAICGQAEYTAGDSKFPVFIGEWSLQTLYNNTLAGRKVIHDTQVYAYQKYVSGSA
FWNVKMINNTAAVDGEGITSDYWSWELLVDQGVITPTINGSYC

Enzyme Prediction     

EC	3.2.1.149:1	3.2.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	158	436	2e-140	0.9964285714285714

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225344	BglC	1.89e-07	137	265	48	172	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATZ56129.1|GH5_23	0.0	1	463	1	463
CCD33736.1|GH5_23	0.0	1	463	1	463
QGI92196.1|GH5_23	5.34e-173	62	463	27	437
QGI78478.1|GH5_23	5.34e-173	62	463	27	437
QGI61298.1|GH5_23	5.34e-173	62	463	27	437

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6LA0_A	2.57e-128	97	457	7	367	Chain A, Glycoside hydrolase family 5 [Aspergillus oryzae],6LA0_B Chain B, Glycoside hydrolase family 5 [Aspergillus oryzae]
6I1A_A	6.66e-120	98	452	11	367	Crystal structure of rutinosidase from Aspergillus niger [Aspergillus niger],6I1A_B Crystal structure of rutinosidase from Aspergillus niger [Aspergillus niger]
6ZB9_A	3.95e-08	108	450	2	362	Chain A, Exo-beta-1,3-glucanase [uncultured bacterium],6ZB9_B Chain B, Exo-beta-1,3-glucanase [uncultured bacterium]
6ZB8_A	2.16e-07	108	450	2	362	Chain A, Exo-beta-1,3-glucanase variant E167Q/E295Q [uncultured bacterium],6ZB8_B Chain B, Exo-beta-1,3-glucanase variant E167Q/E295Q [uncultured bacterium]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A2RAR6|EXGA_ASPNC	3.28e-23	103	389	36	310	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=exgA PE=3 SV=1
sp|A1CRV0|EXGA_ASPCL	1.35e-20	81	389	11	309	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=exgA PE=3 SV=2
sp|B8N151|EXGA_ASPFN	1.36e-19	103	389	25	300	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=exgA PE=3 SV=1
sp|Q7Z9L3|EXGA_ASPOR	1.36e-19	103	389	25	300	Glucan 1,3-beta-glucosidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=exgA PE=1 SV=1
sp|A1D4Q5|EXGA_NEOFI	6.55e-19	109	389	42	310	Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=exgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000254	0.999718	CS pos: 17-18. Pr: 0.9819

TMHMM  Annotations     

There is no transmembrane helices in Bcin12g06590.1:RNA-p1.