CAZyme Information: Bcin12g05620.1:RNA-p1

Basic Information

• Species: Botrytis cinerea
• Lineage: Ascomycota; Leotiomycetes; ; Sclerotiniaceae; Botrytis; Botrytis cinerea
• CAZyme ID: Bcin12g05620.1:RNA-p1
• CAZy Family: GH92
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
387	bcin_chr_12|CGC4	40296.45	7.8656

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_BcinereaB05-10	12073	332648	366	11707

• Gene Location: location=bcin_chr_12:1933196-1934669(+)

Full Sequence      

MMKSSTRLITFITLALSPLINAATTVSGSAYGFAKGVSGGGSAVAAAPSDIAQLKSWLAD
STPRVILIDKTFNFVGSEGSATDTGCYQASCKPSNGGQDYIGTLSCTPGSNIVASTITYD
KAGSTPLVVASSKTLLGVGSAGVIAGKGLRIPATSTNIIIQNIHFTNMNPAHVWGGDAIS
LEGSRGVWIDHCKFSLIGRQMIVSHYAASQFTISNCEFYGTTTTSATCNGNHYWTMMIDG
PNDLLTLDRNYWHNLSGRAPKVSGTNAVVQITNNYMANNAGHDFELYDGTTVLVEGNVLE
NVTLPFSGTGGTVWNVPDSTSATTCASYLGRNCALNTVTNSGAAWPSLKVVAALTTFKQY
GNNWLVTPVAASAVKSSVLANAGVGKI

Enzyme Prediction     

EC	4.2.2.10:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	116	301	2.2e-78	0.9946524064171123

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214765	Amb_all	1.66e-39	116	302	3	189	Amb_all domain.
226384	PelB	1.28e-17	121	387	91	344	Pectate lyase [Carbohydrate transport and metabolism].
366158	Pec_lyase_C	5.54e-12	120	298	23	210	Pectate lyase. This enzyme forms a right handed beta helix structure. Pectate lyase is an enzyme involved in the maceration and soft rotting of plant tissue.
404168	Beta_helix	5.29e-04	177	301	1	112	Right handed beta helix region. This region contains a parallel beta helix region that shares some similarity with Pectate lyases.
404168	Beta_helix	0.004	134	298	17	157	Right handed beta helix region. This region contains a parallel beta helix region that shares some similarity with Pectate lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATZ56024.1|PL1_4	9.48e-280	1	387	1	387
UPK93894.1|CBM1|PL1_4	1.21e-120	23	383	18	381
QDS77588.1|PL1_4	3.89e-114	26	387	45	402
UQC91476.1|CBM1|PL1_4	5.03e-109	23	387	19	380
QKD61651.1|CBM1|PL1_4	6.90e-106	23	383	18	377

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1QCX_A	2.67e-79	26	343	3	321	Pectin Lyase B [Aspergillus niger]
1IDK_A	5.95e-78	26	387	3	359	Pectin Lyase A [Aspergillus niger]
1IDJ_A	2.94e-75	26	387	3	359	Pectin Lyase A [Aspergillus niger],1IDJ_B Pectin Lyase A [Aspergillus niger]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q8NJK6|PELF_ASPNG	2.75e-99	13	387	11	383	Probable pectin lyase F OS=Aspergillus niger OX=5061 GN=pelF PE=3 SV=1
sp|A2R6A1|PELF_ASPNC	2.75e-99	13	387	11	383	Probable pectin lyase F OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=pelF PE=3 SV=1
sp|Q0CZD4|PELF2_ASPTN	9.63e-92	26	387	23	380	Probable pectin lyase F-2 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=pelF-2 PE=3 SV=1
sp|Q2UJA7|PELF_ASPOR	6.77e-91	16	387	4	382	Probable pectin lyase F OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=pelF PE=3 SV=2
sp|B8N316|PELF_ASPFN	6.77e-91	16	387	4	382	Probable pectin lyase F OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=pelF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000282	0.999676	CS pos: 22-23. Pr: 0.9793

TMHMM  Annotations     

There is no transmembrane helices in Bcin12g05620.1:RNA-p1.