CAZyme Information: Bcin12g05220.1:RNA-p1

Basic Information

• Species: Botrytis cinerea
• Lineage: Ascomycota; Leotiomycetes; ; Sclerotiniaceae; Botrytis; Botrytis cinerea
• CAZyme ID: Bcin12g05220.1:RNA-p1
• CAZy Family: GH89
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
474	bcin_chr_12|CGC5	54806.84	6.1627

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_BcinereaB05-10	12073	332648	366	11707

• Gene Location: location=bcin_chr_12:1769871-1771342(+)

Full Sequence      

MSNGILRVKGDQIVDKSDKSVILRGAGLGGWMNMENFITGFPGQEHQHRAAMLKVLGKEK
YEFFFDKFLEYFFMEEDAKFFASLGLNCLRLPFNYRHFEDDMNPRVLKESGFKHLDRVVD
LCAKHKIYTILDMHSVPGSQNPEWHSDNPSNYASFWDHKDHQDRTIWLWSQIAARYRDNP
WVAGYNPINEPCDPQHHRLPEFYTRFESEIRQIDPNHILWLDGNTFAMEWKHFTKILPNC
AYSLHDYSSMGFPTGTPFINSPAQIAQLEASFLRKCTFMHTHSVPSWNGEFGPVYADPSV
EPNASEINNQRYSLLGAQLQIYDKYQIPWCIWLYKDLGLQGMVTASSSSPYNSLTSSFVE
KKRALQLDLWGPPASDSLNKVLDPLVNWIEENAPKAKEQYPTPWGTHRQLLRGVVQTYVV
SSFADEFAELFRGLGEDELDALAGSWKFENCMRREGLNKVLSDFAEVRRRTEGE

Enzyme Prediction     

EC	3.2.1.4:2	3.2.1.37:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	49	336	1.4e-125	0.993006993006993

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225344	BglC	4.26e-17	71	221	72	223	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
395098	Cellulase	8.84e-16	70	338	22	272	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATZ55979.1|GH5_22	0.0	1	474	1	474
CCD52809.1|GH5_22	0.0	1	474	1	474
APA13270.1|GH5_22	0.0	1	474	1	474
QSZ34361.1|GH5_22	3.55e-313	1	473	1	473
QMW26442.1|GH5_22	1.47e-243	1	468	1	468

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1CEC_A	3.60e-17	60	252	16	205	Chain A, ENDOGLUCANASE CELC [Acetivibrio thermocellus]
1CEN_A	8.76e-17	60	252	16	205	Chain A, CELLULASE CELC [Acetivibrio thermocellus],1CEO_A Chain A, CELLULASE CELC [Acetivibrio thermocellus]
1EQP_A	6.05e-12	22	212	8	210	Exo-b-(1,3)-glucanase From Candida Albicans [Candida albicans]
3O6A_A	1.10e-11	22	212	13	215	F144Y/F258Y Double Mutant of Exo-beta-1,3-glucanase from Candida albicans at 2 A [Candida albicans]
1CZ1_A	1.43e-11	22	212	8	210	Exo-b-(1,3)-glucanase From Candida Albicans At 1.85 A Resolution [Candida albicans],1EQC_A Exo-b-(1,3)-glucanase From Candida Albicans In Complex With Castanospermine At 1.85 A [Candida albicans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|W8QRE4|XYL5_PHACH	6.24e-182	6	467	4	471	Beta-xylosidase OS=Phanerodontia chrysosporium OX=2822231 GN=Xyl5 PE=1 SV=2
sp|P0C2S3|GUNC_ACETH	4.17e-17	60	252	16	205	Endoglucanase C OS=Acetivibrio thermocellus OX=1515 GN=celC PE=1 SV=1
sp|P23340|GUNC_CLOSF	7.57e-17	60	252	16	205	Endoglucanase C307 OS=Clostridium sp. (strain F1) OX=1508 GN=celC307 PE=1 SV=1
sp|A3DJ77|GUNC_ACET2	7.57e-17	60	252	16	205	Endoglucanase C OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=celC PE=3 SV=1
sp|Q5B5X8|EXGA_EMENI	1.80e-15	23	233	29	245	Probable glucan 1,3-beta-glucosidase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=exgA PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000077	0.000000

TMHMM  Annotations     

There is no transmembrane helices in Bcin12g05220.1:RNA-p1.