CAZyme Information: Bcin12g01540.1:RNA-p1

Basic Information

• Species: Botrytis cinerea
• Lineage: Ascomycota; Leotiomycetes; ; Sclerotiniaceae; Botrytis; Botrytis cinerea
• CAZyme ID: Bcin12g01540.1:RNA-p1
• CAZy Family: GH76
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
938		105389.64	6.2704

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_BcinereaB05-10	12073	332648	366	11707

• Gene Location: location=bcin_chr_12:553072-556392(+)

Full Sequence      

MSEEFNFQLRSGEQPPILPNTRPMMTERRQSVPVHSMSRSESLAPASRPHSIMSTGSAGS
RDRHTLVAKYLQRRCSAAKWLQPIEEENGTINESSWVGVAMRLPDGSYYTEPPNVDNNFY
TVMQYLGCKVAFTMSSDITAALMDQIGPFQTEVQVHPRGIRLPIVQNLSELAYGGTGVSK
KSYLCVLREERLVLIWNESVESIMTHGADVEGILVGLIWGSHIGTMTATSPYASMTPPIG
QTPGQTPGRTPSAISEDPEFNEKMNIVQAAIEREENKDTIFNPDIEAAAPPERPFLLLHA
GVIGFAMTLVVFVEMLCASRLITEYQWDGGVLRFALVAVIPFFASFSLFFMIVIAGSLFQ
LFGPLTYVRKNSQFYSAKPPKRGRYPDLELPHITIQMPVYKEGLKGVIIPTVTSILAAIR
YYEAQGGSASIYVNEDGMQAVDPELCEARKTFYELNNIGYCSRPKHTHSKKKWYQGKKVQ
DNPEGFQRKGQFKKASNMNYCLSFSIRVEDELLRLIAAKSAAEDRPEGGITPDEEDVLYK
QALATCLEQDEGRTMAGGNVRIGDIILIIDSDTRVPEDCLLLGALEMHESPQVAILQHAS
GVMQVAHNPFENGITYFTNLIYMSITFAVGNGDCAPFVGHNAFLRWKAVQSVAYEEDGQL
KFWSDDHVSEDFDMSLRLQMAKFIVRLATYHEGGFKEGVSLTVYDELARWEKYAYGCNEL
VFNPIYKWWRGPFTKLFMRFLWSDIKLTSKITILAYIGTYYAIACAIPLTLANYIMVGWF
NDSLDQFYLTSWKIFVGMAVIFNVLSPLAFAMLRHRLGEKVFVYSIVETAKWTPMFVLFF
GGISFHLLTAILCHFFSIKMEWTATAKEVEAGGFRIGLDKIFRDFKWMYLVMIPILGGMV
YLGAFAPRGFDITDFTAIVPLSNQVACHILLPFALGLF

Enzyme Prediction     

No EC number prediction in Bcin12g01540.1:RNA-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	565	773	3e-54	0.9746192893401016

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
404513	Glyco_trans_2_3	4.80e-53	565	777	1	194	Glycosyl transferase family group 2. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.
133045	CESA_like	2.94e-09	563	671	79	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
224136	BcsA	3.47e-09	563	871	138	428	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
133034	Glucan_BSP_MdoH	6.59e-05	564	709	97	243	Glucan_BSP_MdoH catalyzes the elongation of beta-1,2 polyglucose chains of glucan. Periplasmic Glucan Biosynthesis protein MdoH is a glucosyltransferase that catalyzes the elongation of beta-1,2 polyglucose chains of glucan, requiring a beta-glucoside as a primer and UDP-glucose as a substrate. Glucans are composed of 5 to 10 units of glucose forming a highly branched structure, where beta-1,2-linked glucose constitutes a linear backbone to which branches are attached by beta-1,6 linkages. In Escherichia coli, glucans are located in the periplasmic space, functioning as regulator of osmolarity. It is synthesized at a maximum when cells are grown in a medium with low osmolarity. It has been shown to span the cytoplasmic membrane.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATZ55570.1|GT0	0.0	1	938	1	938
APA12832.1|GT0	0.0	1	938	1	938
QSZ28760.1|GT0	0.0	1	913	1	913
CCD53801.1|GT0	0.0	1	617	1	617
QIW95398.1|GT0	0.0	63	938	45	921

PDB Hits     

Bcin12g01540.1:RNA-p1 has no PDB hit.

Swiss-Prot Hits     

Bcin12g01540.1:RNA-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000077	0.000000

TMHMM  Annotations     

Start	End
300	322
334	356
753	775
788	810
836	858
887	905
915	937