CAZyme Information: Bcin12g00930.1:RNA-p1

Basic Information

• Species: Botrytis cinerea
• Lineage: Ascomycota; Leotiomycetes; ; Sclerotiniaceae; Botrytis; Botrytis cinerea
• CAZyme ID: Bcin12g00930.1:RNA-p1
• CAZy Family: PL1
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
401		43375.06	9.3533

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_BcinereaB05-10	12073	332648	366	11707

• Gene Location: location=bcin_chr_12:329232-330483(+)

Full Sequence      

MSYNQGGYGQQGGYGQQGGYGQQGGYGQQQQPHGEASEYYNQGQNNGYGQQQQYGGGQGG
YGQDPSQYQQYPSTAAHSSNSGRNSHNQGFQNQYNGEGDPEGDRGIMGGLAGGAAGAYGG
HKLGGQAGHGTAGTILGALTGAFAGSKTQDAVGDWKDEHAEKKKWEKEQEERQKREKYNQ
QHYGGPPPRRRRGSSCSRSRSRSRSRSRSHSRSRSRSHSRSRGIDRSRGDERIRGDFGGN
FTTSSNDVRLDSHGDYNLHAQCRRTDGSYQSSTISLNRYIENDNGSLRWSSGGGGHGGST
YTVQQGDTLRAIADRFSHCSYEELARHNNINNPDQIWPGQNLRVPGGGGHGGGGNFGASA
RNVRLSRSGQELEAELAPSWHTSTLNLDERIGNNNGCLQFV

Enzyme Prediction     

No EC number prediction in Bcin12g00930.1:RNA-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
400991	CVNH	1.40e-19	241	399	1	101	CVNH domain. CyanoVirin-N Homology domains are found in the sugar-binding antiviral protein cyanovirin-N (CVN) as well as filamentous ascomycetes and in the fern Ceratopteris richardii.
212030	LysM	1.31e-12	300	344	2	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
396179	LysM	1.45e-11	301	345	1	43	LysM domain. The LysM (lysin motif) domain is about 40 residues long. It is found in a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. The structure of this domain is known.
197609	LysM	2.04e-11	300	344	1	44	Lysin motif.
236880	PRK11198	2.47e-06	301	345	98	146	LysM domain/BON superfamily protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATZ55501.1|CBM50	3.68e-175	1	401	1	401
CCD53721.1|CBM50	1.40e-173	1	401	1	395
CAE7030402.1|CBM50	3.14e-82	65	401	82	387
QRC90594.1|CBM50	1.26e-72	236	401	201	366
UQC79577.1|CBM50	2.81e-61	237	401	218	382

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2L9Y_A	6.42e-43	237	396	3	162	Solution structure of the MoCVNH-LysM module from the rice blast fungus Magnaporthe oryzae protein (MGG_03307) [Pyricularia oryzae 70-15]
5C8O_A	5.65e-39	237	396	6	149	Crystal structure of MoCVNH3 variant (Mo0v) [Pyricularia oryzae],5C8P_A Crystal structure of MoCVNH3 variant (Mo0v) in complex with (N-GlcNAc)3 [Pyricularia oryzae],5C8Q_B Crystal structure of MoCVNH3 variant (Mo0v) in complex with (N-GlcNAc)4 [Pyricularia oryzae]
2L2F_A	4.28e-06	239	401	2	107	Chain A, Cyanovirin-N HOMOLOG [Fusarium graminearum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9RVY3|Y888_DEIRA	2.43e-07	297	346	202	253	Uncharacterized protein DR_0888 OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) OX=243230 GN=DR_0888 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000070	0.000000

TMHMM  Annotations     

There is no transmembrane helices in Bcin12g00930.1:RNA-p1.