CAZyme Information: Bcin11g02280.1:RNA-p1

Basic Information

• Species: Botrytis cinerea
• Lineage: Ascomycota; Leotiomycetes; ; Sclerotiniaceae; Botrytis; Botrytis cinerea
• CAZyme ID: Bcin11g02280.1:RNA-p1
• CAZy Family: GH71|CBM24
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
552	bcin_chr_11|CGC7	62339.56	8.0575

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_BcinereaB05-10	12073	332648	366	11707

• Gene Location: location=bcin_chr_11:774046-775704(-)

Full Sequence      

MTELSTRARKIRLKMKKLVQKAKDHIRSGSSSSQTSPLDSSRPVHNIHQSRPSTISQPTL
REILRYRYHFGVNLGSIFVLEPWLFPKFVGGASSELDAVTSSVKNNGVEATRQKWEGHWK
NAVTDQAFGWLAKSAKGTSIRLPVGYFTLGPEFCVGTPFESAKDVYQNSWTIVKEFITRA
RALGVGVLVDLHALPGGANTDMHSGSSTGKAELWSSKKNLELAKKALLFIAKECKGLDGV
IGIQLCNEACWDAGKKGMYDFYTSVIQSISEVDSEVPIYISDAWDLSSALKWTKERDWRS
GKVPSNPVVIDTHKYYTFAEKHRSQSAQELVRQIPNELGELPNCSPSATHISSGGETQIV
IGEYSCVLDEKSWAKSPPSMKEELTRDFGRHQCNKWTEGCSAGSYFWTWKMEWMDGGGWG
FVEQVKKGNIVAPAYMGWSAKEIREKSRKASEQKNELMQKMVKDHIDYWTHEDPGKEFRH
DLYEKGWDIGWEDAKAFFGSRGEQGGADKLGSLEIWIKKRMIESGERGEFLWEWEQGFRW
GVKEFENCVEIA

Enzyme Prediction     

No EC number prediction in Bcin11g02280.1:RNA-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	114	417	1e-111	0.9965870307167235

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225344	BglC	3.06e-20	71	284	20	228	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
395098	Cellulase	8.74e-04	116	278	16	163	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATZ54913.1|GH5_49	0.0	1	552	1	552
CCD47737.1|GH5_49	0.0	1	552	1	552
QSZ29891.1|GH5_49	0.0	15	551	1	537
APA06019.1|GH5_49	0.0	15	551	1	537
QGA13295.1|GH5_49	3.95e-150	56	549	6	508

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1EQP_A	3.35e-11	71	370	11	293	Exo-b-(1,3)-glucanase From Candida Albicans [Candida albicans]
1CZ1_A	4.45e-11	71	370	11	293	Exo-b-(1,3)-glucanase From Candida Albicans At 1.85 A Resolution [Candida albicans],1EQC_A Exo-b-(1,3)-glucanase From Candida Albicans In Complex With Castanospermine At 1.85 A [Candida albicans]
2PB1_A	4.57e-11	71	370	17	299	Exo-B-(1,3)-Glucanase from Candida Albicans in complex with unhydrolysed and covalently linked 2,4-dinitrophenyl-2-deoxy-2-fluoro-B-D-glucopyranoside at 1.9 A [Candida albicans]
3O6A_A	8.04e-11	71	370	16	298	F144Y/F258Y Double Mutant of Exo-beta-1,3-glucanase from Candida albicans at 2 A [Candida albicans]
2PC8_A	1.07e-10	71	370	17	299	Chain A, Hypothetical protein XOG1 [Candida albicans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P38081|YBQ6_YEAST	1.14e-73	63	547	40	500	Uncharacterized glycosyl hydrolase YBR056W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YBR056W PE=1 SV=1
sp|O74799|EXG3_SCHPO	5.59e-70	61	537	6	444	Glucan 1,3-beta-glucosidase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=exg3 PE=3 SV=1
sp|Q7Z9L3|EXGA_ASPOR	9.32e-20	71	416	33	380	Glucan 1,3-beta-glucosidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=exgA PE=1 SV=1
sp|B8N151|EXGA_ASPFN	9.32e-20	71	416	33	380	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=exgA PE=3 SV=1
sp|D4AJL7|EXG1_ARTBC	1.88e-18	71	433	36	402	Probable glucan 1,3-beta-glucosidase ARB_04467 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_04467 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000059	0.000000

TMHMM  Annotations     

There is no transmembrane helices in Bcin11g02280.1:RNA-p1.