CAZyme Information: Bcin10g05010.1:RNA-p1

Basic Information

• Species: Botrytis cinerea
• Lineage: Ascomycota; Leotiomycetes; ; Sclerotiniaceae; Botrytis; Botrytis cinerea
• CAZyme ID: Bcin10g05010.1:RNA-p1
• CAZy Family: GH55
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
447		47228.46	6.5560

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_BcinereaB05-10	12073	332648	366	11707

• Gene Location: location=bcin_chr_10:1885753-1887683(-)

Full Sequence      

MRLNLKAILLSASLFLPSLVSAQLASGYPIGPLTTSDAKWAKKVCDVTKYGAVADGKTDL
GPPLLAAFNACSSGGVVNIPSGNYAMSTWVTLSGGKAWAINLEGVIFRTGTAGGHMIVVE
DSTDFELYSSRSSGAIQGYGYVFHAQGIYGPRLIRLINVVNFSIHDIALVDSPAFHLILD
TVQNGQVYNLIIRGGNEGGLDGIDVWGFNVHIHDVEVTNKDECVTVKNPSNHMLIENIHC
NVSGGCAIGSLGADTAISKITYNNIYSWQSNQMFMIKSNGGSGSVSDSVFSNFIGHSNAY
SLDIDAYWKSTPATGNGVLYTGLTFSNWKGTCADGTLRAPIQLICPTGQPCAGLSITNFA
MWTDTGSYELYKCQNAWGDGGCLVHGSAHTAYSIVTQTVSSAPAGYSAAKMPNDLAAGYA
LTASIPIPTIPTTFFPGQVPATKRAYP

Enzyme Prediction     

EC	3.2.1.171:11

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH28	71	376	2.2e-46	0.96

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
177865	PLN02218	2.10e-15	47	376	70	418	polygalacturonase ADPG
215540	PLN03010	1.74e-14	46	379	48	392	polygalacturonase
215120	PLN02188	1.57e-13	46	376	38	390	polygalacturonase/glycoside hydrolase family protein
395231	Glyco_hydro_28	1.03e-12	151	376	85	315	Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes are important in cell wall metabolism.
215426	PLN02793	3.85e-12	41	401	49	436	Probable polygalacturonase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCD51054.2|GH28	0.0	1	447	1	447
ATZ54503.1|GH28	0.0	1	447	1	447
APA10459.1|GH28	0.0	1	447	1	447
QSZ34997.1|GH28	7.25e-247	1	444	1	436
QKX61808.1|GH28	2.30e-216	18	446	15	437

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1RMG_A	5.16e-193	30	445	6	421	Rhamnogalacturonase A From Aspergillus Aculeatus [Aspergillus aculeatus]
4C2L_A	2.95e-19	41	381	15	379	Crystal structure of endo-xylogalacturonan hydrolase from Aspergillus tubingensis [Aspergillus tubingensis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B0Y0Q3|RHGB_ASPFC	1.11e-198	9	440	8	439	Probable rhamnogalacturonase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=rhgB PE=3 SV=1
sp|A1DED1|RHGB_NEOFI	1.87e-198	9	440	8	439	Probable rhamnogalacturonase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=rhgB PE=3 SV=1
sp|Q4WV23|RHGB_ASPFU	6.35e-198	9	440	8	439	Probable rhamnogalacturonase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=rhgB PE=3 SV=1
sp|Q00001|RHGA_ASPAC	9.29e-195	5	445	1	439	Rhamnogalacturonase A OS=Aspergillus aculeatus OX=5053 GN=rhgA PE=1 SV=1
sp|A2QYE5|RHGA_ASPNC	4.51e-187	17	437	13	432	Probable rhamnogalacturonase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=rhgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000233	0.999760	CS pos: 22-23. Pr: 0.9784

TMHMM  Annotations     

There is no transmembrane helices in Bcin10g05010.1:RNA-p1.