CAZyme Information: Bcin09g06500.2:RNA-p1

Basic Information

• Species: Botrytis cinerea
• Lineage: Ascomycota; Leotiomycetes; ; Sclerotiniaceae; Botrytis; Botrytis cinerea
• CAZyme ID: Bcin09g06500.2:RNA-p1
• CAZy Family: GH5
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
542	bcin_chr_9|CGC12	61087.95	5.4723

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_BcinereaB05-10	12073	332648	366	11707

• Gene Location: location=bcin_chr_9:2301626-2303254(-)

Full Sequence      

MDPAIKSELEKYGDDVPFRAVTNHTQSTWARTFHSSPELFIQPQSIAEVEKVVNLARRCR
RRITTVGCGHSPSNITCTSSWLINLDNFNKILSADRETGVVVMQSGIRLYSVGEQLDAVG
LAMPNLGSINHQSIAGAISTGTHGSTLRHGILSSSILELKITLSNGKTETCSPDQNEELF
RASLISLGAIGIITEITFQAVPAFTLSWEQTVDTDLRMMNNWDKTLWTQTEFVRVWWFPY
TRRAVVWAAEKTDLAPMPPPKSYYDAWLGYHVYHNLLALGHYVPSILPWVEWFVFGMQYG
FANGSKSSAIQPSRQALLMNCLYSQFVNEWAIPISKGPEALKRLSSWLNHLTPDDPDYVA
HGIPYSAEGLYVHAPVEVRVTETSNSLTPRPHLDPTCTEEATLYLNATLYRPYDMDPPCH
ARYYQGFEFLMRELGGRPHWAKNFETTGEDIEAMYGENLENWRRIRNDADPEGMFVGEWH
RRFILGNGSRLALEEVETGRKKFRKGGVLVEGVVGGFKDEEDEGEGSESGESFDMLRASE
MK

Enzyme Prediction     

EC	1.1.3.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA7	26	209	1.2e-25	0.4148471615720524

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
273751	FAD_lactone_ox	1.35e-147	27	475	5	435	sugar 1,4-lactone oxidases. This model represents a family of at least two different sugar 1,4 lactone oxidases, both involved in synthesizing ascorbic acid or a derivative. These include L-gulonolactone oxidase (EC 1.1.3.8) from rat and D-arabinono-1,4-lactone oxidase (EC 1.1.3.37) from Saccharomyces cerevisiae. Members are proposed to have the cofactor FAD covalently bound at a site specified by Prosite motif PS00862; OX2_COVAL_FAD; 1.
397924	ALO	2.61e-103	196	482	1	258	D-arabinono-1,4-lactone oxidase. This domain is specific to D-arabinono-1,4-lactone oxidase EC:1.1.3.-, which is involved in the final step of the D-erythroascorbic acid biosynthesis pathway.
215258	PLN02465	4.98e-37	24	479	84	565	L-galactono-1,4-lactone dehydrogenase
223354	GlcD	3.57e-36	30	475	25	450	FAD/FMN-containing dehydrogenase [Energy production and conversion].
130737	GLDHase	3.11e-30	24	259	49	283	galactonolactone dehydrogenase. This model represents L-Galactono-gamma-lactone dehydrogenase (EC 1.3.2.3). This enzyme catalyzes the final step in ascorbic acid biosynthesis in higher plants. This protein is homologous to ascorbic acid biosynthesis enzymes of other species: L-gulono-gamma-lactone oxidase in rat and L-galactono-gamma-lactone oxidase in yeast. All three covalently bind the cofactor FAD.

CAZyme Hits     

Bcin09g06500.2:RNA-p1 has no CAZyme hit.

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7A24_z	4.90e-27	24	259	110	344	Assembly intermediate of the plant mitochondrial complex I [Brassica oleracea]
2VFR_A	1.56e-19	25	216	9	194	Alditol Oxidase from Streptomyces coelicolor A3(2): Native Enzyme [Streptomyces coelicolor A3(2)],2VFS_A Alditol Oxidase from Streptomyces coelicolor A3(2): Complex with Xylitol [Streptomyces coelicolor A3(2)],2VFT_A Alditol Oxidase from Streptomyces coelicolor A3(2): Complex with Sorbitol [Streptomyces coelicolor A3(2)],2VFU_A Alditol Oxidase from Streptomyces coelicolor A3(2): Complex with Mannitol [Streptomyces coelicolor A3(2)],2VFV_A Alditol Oxidase from Streptomyces coelicolor A3(2): Complex with Sulphite [Streptomyces coelicolor A3(2)]
4ML8_A	2.13e-08	24	203	31	219	Structure of maize cytokinin oxidase/dehydrogenase 2 (ZmCKO2) [Zea mays],4ML8_B Structure of maize cytokinin oxidase/dehydrogenase 2 (ZmCKO2) [Zea mays],4ML8_C Structure of maize cytokinin oxidase/dehydrogenase 2 (ZmCKO2) [Zea mays],4ML8_D Structure of maize cytokinin oxidase/dehydrogenase 2 (ZmCKO2) [Zea mays],4MLA_A Structure of maize cytokinin oxidase/dehydrogenase 2 (ZmCKO2) [Zea mays],4MLA_B Structure of maize cytokinin oxidase/dehydrogenase 2 (ZmCKO2) [Zea mays]
6EO4_A	4.43e-07	5	199	14	214	Physcomitrella patens BBE-like 1 wild-type [Physcomitrium patens],6EO4_B Physcomitrella patens BBE-like 1 wild-type [Physcomitrium patens]
6EO5_A	4.43e-07	5	199	14	214	Physcomitrella patens BBE-like 1 variant D396N [Physcomitrium patens],6EO5_B Physcomitrella patens BBE-like 1 variant D396N [Physcomitrium patens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q7SGY1|ALO_NEUCR	2.05e-232	16	513	30	549	Putative D-arabinono-1,4-lactone oxidase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=alo-1 PE=3 SV=1
sp|Q6CG88|ALO_YARLI	3.99e-117	24	476	13	514	D-arabinono-1,4-lactone oxidase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=ALO1 PE=3 SV=1
sp|Q6BZA0|ALO_DEBHA	7.10e-100	22	476	15	542	D-arabinono-1,4-lactone oxidase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / BCRC 21394 / JCM 1990 / NBRC 0083 / IGC 2968) OX=284592 GN=ALO1 PE=3 SV=2
sp|O93852|ALO1_CANAL	1.00e-99	27	476	19	543	D-arabinono-1,4-lactone oxidase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ALO1 PE=1 SV=1
sp|Q6CSY3|ALO_KLULA	2.26e-99	14	479	4	516	D-arabinono-1,4-lactone oxidase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) OX=284590 GN=ALO1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000034	0.000000

TMHMM  Annotations     

There is no transmembrane helices in Bcin09g06500.2:RNA-p1.