CAZyme Information: Bcin09g05950.1:RNA-p1

Basic Information

• Species: Botrytis cinerea
• Lineage: Ascomycota; Leotiomycetes; ; Sclerotiniaceae; Botrytis; Botrytis cinerea
• CAZyme ID: Bcin09g05950.1:RNA-p1
• CAZy Family: GH5
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
531		59592.11	6.1264

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_BcinereaB05-10	12073	332648	366	11707

• Gene Location: location=bcin_chr_9:2081894-2083489(-)

Full Sequence      

MSLDSSDTTMEKLRRTRSRSMQTTSQFSGRLPKQIQRALPVYAILVLFILIISNVDTLKS
STVSHAKRSTQKILKGSTTADFPRKIWQTWKVDPLGFAERDLLSARTWTQLNPGHRYEVL
TDNNDMYYVETHFGPDELDRPDIVEMYRSLKVQIIKADLLRYLIMYVEGGVYTDIDVEAL
KAVNAWIPDRYSVGDVDMVVSVEIDQPEFKDHPILGQKSQSFCQWTFMCKPRLPVMLALV
DNILLWLNDVAAKQNVPISEIKLDFDEVISGTGPSAFTGAILKEMTIKTGDQVDWSTFHA
MRESKLVGGFLVLTVEAFAAGQGHSDSGNHNARGALVKHHYHASEWPLLHPRFSHPIYGE
VEKCNWEPECVRIWDENMAAYEKLSPEEKEQQIAIKKALDEHDALHAKMGAQKLDLNALN
MPQQNLNPIPQAAIPMPQPGFHPDGSPVRNLDGSIMRNLDGSLPINPNAPPPAQKLEIKD
LPAPKADPAPPNQPQIQPAPEVKAKDMKTEEKNTPKDSQTEPKGEIFLGAV

Enzyme Prediction     

No EC number prediction in Bcin09g05950.1:RNA-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	104	188	2.7e-18	0.9111111111111111

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	3.06e-23	80	247	80	247	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	1.71e-13	99	192	2	92	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATZ53824.1|GT32	0.0	1	531	1	531
CCD47871.2|GT32	0.0	10	531	1	522
APA11992.1|GT32	3.84e-307	10	530	1	515
QSZ34857.1|GT32	2.00e-301	10	501	1	493
QRD83354.1|GT32	1.70e-173	24	400	2	373

PDB Hits     

Bcin09g05950.1:RNA-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9UTR6|OCH1_SCHPO	2.16e-30	80	346	140	393	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|Q5A4E3|OCH1_CANAL	4.21e-27	82	344	99	374	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|P47124|HOC1_YEAST	1.63e-21	82	318	130	361	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3
sp|P31755|OCH1_YEAST	3.49e-19	80	261	94	300	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1
sp|Q10323|IMT3_SCHPO	3.00e-07	79	227	54	193	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999943	0.000048

TMHMM  Annotations     

There is no transmembrane helices in Bcin09g05950.1:RNA-p1.