CAZyme Information: Bcin09g04020.1:RNA-p1

Basic Information

• Species: Botrytis cinerea
• Lineage: Ascomycota; Leotiomycetes; ; Sclerotiniaceae; Botrytis; Botrytis cinerea
• CAZyme ID: Bcin09g04020.1:RNA-p1
• CAZy Family: GH43|CBM91
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
430	bcin_chr_9|CGC13	48209.95	5.1534

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_BcinereaB05-10	12073	332648	366	11707

Full Sequence      

MKSSMISSIILSLSCVVTATIWQNDQVRITNYPDTKIDLNSSVFADYPPSAPELSYKGRW
DSKYVSWWSAPGLKFGFTGEKVAITFGPLTSDTVLVGYRVNGQDWQLTNITTNATHLLVS
PESPAIDVGWPINPSTFELRVTNWAYGVQISAVHLSKGERLIKIPKSSRTIEFIGDSLSS
GYTATLEGLSSFAYGMGAGLGNTEYSITAYPGVCLVDQLCWGNTRGMFHQWYYTSDTSPR
ATQIWGDKPELWDFSKQDDADIVVINLGTNDSNGAINVTSSEYVAQYTLLIEGIHAVWPN
AQIVLMSLWEGFFAYGNSYAQAQGFASEIYNIYQYFNSEKYLSNPVLYNPRTNSTYSSHQ
RSAPFVSYFNTTGLMQHNDINPAYHPTDVGHIKVASHLIQYVRMKFGWELYANGPEIFHD
TLYWNDIQSY

Enzyme Prediction     

No EC number prediction in Bcin09g04020.1:RNA-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE2	171	402	2.9e-21	0.9904306220095693

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238869	Endoglucanase_E_like	7.85e-34	171	403	2	169	Endoglucanase E-like members of the SGNH hydrolase family; Endoglucanase E catalyzes the endohydrolysis of 1,4-beta-glucosidic linkages in cellulose, lichenin and cereal beta-D-glucans.
238141	SGNH_hydrolase	2.61e-11	171	401	1	187	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
404371	Lipase_GDSL_2	2.45e-09	173	391	1	174	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
395531	Lipase_GDSL	1.13e-04	171	398	1	224	GDSL-like Lipase/Acylhydrolase.
238879	NnaC_like	5.53e-04	261	308	53	98	NnaC (CMP-NeuNAc synthetase) _like subfamily of SGNH_hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles two of the three components of typical Ser-His-Asp(Glu) triad from other serine hydrolases. E. coli NnaC appears to be involved in polysaccharide synthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATZ53576.1|CE0	ATZ53576.1|CE0	0.0	1	430	1	430
CCD44707.1|CE0	CCD44707.1|CE0	0.0	1	430	1	430
APA11901.1|CE0	APA11901.1|CE0	4.88e-281	1	430	1	430
EAA35351.3|CE0	EAA35351.3|CE0	3.80e-197	18	430	18	432
AEO54717.1|CE0	AEO54717.1|CE0	8.67e-194	11	430	12	433

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4XVH_A	4XVH_A	8.61e-07	54	307	2	255	Crystal structure of a Corynascus thermopiles (Myceliophthora fergusii) carbohydrate esterase family 2 (CE2) enzyme plus carbohydrate binding domain (CBD) [Chaetomium]

Swiss-Prot Hits     

Bcin09g04020.1:RNA-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.001865	0.998125	CS pos: 19-20. Pr: 0.9504

TMHMM  Annotations     

There is no transmembrane helices in Bcin09g04020.1:RNA-p1.