CAZyme Information: Bcin09g01210.1:RNA-p1

Basic Information

• Species: Botrytis cinerea
• Lineage: Ascomycota; Leotiomycetes; ; Sclerotiniaceae; Botrytis; Botrytis cinerea
• CAZyme ID: Bcin09g01210.1:RNA-p1
• CAZy Family: GH38
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
930	bcin_chr_9|CGC9	105853.04	6.9353

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_BcinereaB05-10	12073	332648	366	11707

• Gene Location: location=bcin_chr_9:458930-462212(+)

Full Sequence      

MSYNRLDPAGQGQDDYYNMNNRHQSPHPQGYQLEDAPYGRPNTTSPGPGMHNLEIPMGPG
AHRIGTPSDQLQAQPSYSVEHLDQNQYHQRMPLNPSQSYDSEYSLDPNAHHDAYYQPPYQ
PSPHEEHPLQNYAPGQDPYAYNDDDDHQPILQSHEPYGPDPHSASGTDYKGGYDGTVQSP
SATPVPALRRYKTVKEVQLFNGNLVLDCPIPPKLLNQVNHAPPPERDEFTHMRYSAATCD
PSEFFEERFTLRQKLFAKPRHTELFIVVTMYNEDDVLFARTMHGVFKNIEFMCTRKDSKT
WGKDAWKKIVVCVVSDGRAKINPRTRAVLAGLGVYQDGIAKQQVNGKDVTAHIYEYTTQV
GISLKKDIVTLTPKQQPVQLLFCLKEKNQKKINSHRWFFQAFGRVLDPNICVLLDAGTKP
GKDSIYHLWKAFDLEPHCAGACGEIKAMLGPGGKNLVNPLVATQNFEYKMSNILDKPLES
AFGFISVLPGAFSAYRYVALQNDKTGNGPLEKYFAGEKMHGANAGIFTANMYLAEDRILC
FELVSKRNCHWILQYVKSATGETDVPDTMAELILQRRRWLNGSFFAAIYALAHFYQIFRS
DHSFLRKIMFLIEFTYQTINMIFAWFALGNFFLVFHILTTSLGSSDLLGNVGVILGVVFE
WLYLFTLLTCFILALGNRPQGTNKVYMSMVYFWIIIMIYLMFASIFITVKSIQTQLAKDE
FNWTDIIKNQIFYTLIISLASTYLLWFISSFLFFDPWHMFTSFLQYLLLTPTYINILNVY
AFCNTHDITWGTKGDDKAEKLPSAVLKAGGKVDVNIPTDDGDLNAQYESEMRKIQIKAPP
EKREFSAEEKQEDYYKWFRSSVVLFWLVCNFALTSAVLSTAGLEKFGTGTDDTTKSTIYM
AVVLWSVAGLSCFKFIGAMWFLIVRMFRGV

Enzyme Prediction     

EC	2.4.1.16:26	2.4.1.16:26

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	270	432	5.3e-77	0.9938650306748467

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396286	Chitin_synth_1	6.58e-112	270	432	1	163	Chitin synthase. This region is found commonly in chitin synthases classes I, II and III. Chitin a linear homopolymer of GlcNAc residues, it is an important component of the cell wall of fungi and is synthesized on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases.
133033	Chitin_synth_C	4.33e-100	266	586	1	244	C-terminal domain of Chitin Synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin. Chitin synthase, also called UDP-N-acetyl-D-glucosamine:chitin 4-beta-N-acetylglucosaminyltransferase, catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of GlcNAc residues formed by covalent beta-1,4 linkages. Chitin is an important component of the cell wall of fungi and bacteria and it is synthesized on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases. Studies with fungi have revealed that most of them contain more than one chitin synthase gene. At least five subclasses of chitin synthases have been identified.
400626	Chitin_synth_1N	3.17e-35	196	269	1	70	Chitin synthase N-terminal. This is the N-terminal domain of Chitin synthase (pfam01644).
224136	BcsA	5.82e-31	381	703	115	401	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
133045	CESA_like	1.93e-15	266	500	1	166	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATZ53246.1|GT2	0.0	1	930	1	930
APA11540.1|GT2	0.0	1	930	1	929
AAS21658.1|GT2	0.0	1	794	1	794
QSZ36765.1|GT2	0.0	19	930	1	917
VCU40889.1|GT2	0.0	114	930	5	786

PDB Hits     

Bcin09g01210.1:RNA-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P30601|CHS2_EXODE	0.0	69	926	60	917	Chitin synthase 2 OS=Exophiala dermatitidis OX=5970 GN=CHS2 PE=3 SV=2
sp|P30588|CHS3_NEUCR	0.0	30	930	18	888	Chitin synthase 3 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=chs-3 PE=3 SV=2
sp|P30583|CHSC_EMENI	0.0	1	930	1	918	Chitin synthase C OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=chsC PE=3 SV=3
sp|Q12564|CHSA_AMPQU	0.0	77	926	45	898	Chitin synthase A OS=Ampelomyces quisqualis OX=50730 GN=CHSA PE=3 SV=1
sp|P30595|CHS2_RHIOL	3.64e-297	178	929	108	858	Chitin synthase 2 OS=Rhizopus oligosporus OX=4847 GN=CHS2 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000071	0.000000

TMHMM  Annotations     

Start	End
478	500
579	598
618	640
653	675
685	707
731	753
763	782
860	882
902	924