CAZyme Information: Bcin09g00190.1:RNA-p1

Basic Information

• Species: Botrytis cinerea
• Lineage: Ascomycota; Leotiomycetes; ; Sclerotiniaceae; Botrytis; Botrytis cinerea
• CAZyme ID: Bcin09g00190.1:RNA-p1
• CAZy Family: GH35
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
462		50056.93	4.2935

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_BcinereaB05-10	12073	332648	366	11707

• Gene Location: location=bcin_chr_9:74701-76417(-)

Full Sequence      

MLPTFALSAATALLFSSSMVNAEIELNLDDDTSIKNAAATIAYDMMTYYKGNQSGGIPGV
LPGPPPDPPTGYYWWESGAMWGSLIDYWYYTGDSSYNDDAMAGIQWQTGANNDMMPANWS
QSMGNDDQGFWGMTAMTAAETKFQDPPSDRPGWLALAQAVFNTQAVRIDNATCGGGLRWQ
VYPYLTGYNYKNSIANGCFFNIGARLARYTNNETYAQYAEETWNWVTSVGYMDKEYNIYD
GAHIEENCTDINKVQFSYNSGVYLLGAATMYNHTNGSDIWKERVDGLLNATFKNFFPTGD
IAYEIACEAKLSCTTDMYSFKAFLTRWLAGTTKMAPYTYDLIMPYLKASAVAAAKQCSGP
SPFAGRTCGLSWSKGTDWDGTSGVGQQMAAMSAIFVNLVQKTQAPVTNSTGGTSVGNSAA
GSGSSNSLDSVKPPSTGDRVGAGMVTTVVLVGMTGMFGWMSL

Enzyme Prediction     

EC	3.2.1.101:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	32	408	3.4e-107	0.9608938547486033

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397638	Glyco_hydro_76	1.48e-175	33	391	1	348	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.
227170	COG4833	5.90e-06	149	264	93	215	Predicted alpha-1,6-mannanase, GH76 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATZ53131.1|GH76	0.0	1	462	1	462
CCD34628.1|GH76	2.84e-315	45	462	1	418
APA11453.1|GH76	8.78e-314	1	461	1	461
QSZ36850.1|GH76	1.11e-300	1	461	1	461
VCU41163.1|GH76	4.23e-239	22	462	19	457

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6RY0_A	1.98e-142	17	439	19	443	Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY1_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY2_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY5_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY6_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY7_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q6FLP9|DCW1_CANGA	1.56e-128	24	460	19	444	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) OX=284593 GN=DCW1 PE=3 SV=1
sp|P36091|DCW1_YEAST	9.74e-128	14	460	13	447	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DCW1 PE=1 SV=1
sp|O74556|YCZ2_SCHPO	3.91e-117	24	421	20	407	Putative mannan endo-1,6-alpha-mannosidase C970.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC970.02 PE=3 SV=1
sp|Q05031|DFG5_YEAST	1.83e-116	24	460	27	456	Mannan endo-1,6-alpha-mannosidase DFG5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DFG5 PE=1 SV=1
sp|Q75DG6|DCW1_ASHGO	9.59e-112	4	449	5	438	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) OX=284811 GN=DCW1 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000314	0.999682	CS pos: 22-23. Pr: 0.9732

TMHMM  Annotations     

There is no transmembrane helices in Bcin09g00190.1:RNA-p1.