CAZyme Information: Bcin08g06160.1:RNA-p1

Basic Information

• Species: Botrytis cinerea
• Lineage: Ascomycota; Leotiomycetes; ; Sclerotiniaceae; Botrytis; Botrytis cinerea
• CAZyme ID: Bcin08g06160.1:RNA-p1
• CAZy Family: GH32
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
349	bcin_chr_8|CGC9	37379.20	6.0927

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_BcinereaB05-10	12073	332648	366	11707

• Gene Location: location=bcin_chr_8:2296312-2297424(-)

Full Sequence      

MKFFYTVLAFAPQVFAALTYKGVDWSSVTVEEGSGYTYKNTAGTTQALETILAASGVNTV
RQRIWVNPSSGQYNLAYNLALAKRAKAAGLKIYLDLHFSDTWADPSHQAIPSGWPTDTVG
NLAWEVYNYTLAVSDAFASAGISPSIISIGNEIRAGLLWPIGTTSSYYNIASLLHSASAG
IKDSTLATKPKIMIHLDNGYSWSEQQYFYKTVLAAGPLLTTDFDMMGVSYYPFYSSAATL
ASLKTSLTNMASTWGKQLVVAETNWPFACPSPAYTFPSDTTSIPFSAAGQTTWIKDVAAV
VAGVSGGVGLFYWEPAWINNAALGSSCSDAILFDSKGVARSSLSAFASI

Enzyme Prediction     

EC	3.2.1.89:16

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH53	20	346	1.1e-98	0.9970760233918129

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
311610	Glyco_hydro_53	5.95e-116	20	346	1	333	Glycosyl hydrolase family 53. This domain belongs to family 53 of the glycosyl hydrolase classification. These enzymes are enzymes are endo-1,4- beta-galactanases (EC:3.2.1.89). The structure of this domain is known and has a TIM barrel fold.
226385	GanB	2.55e-57	21	346	41	391	Arabinogalactan endo-1,4-beta-galactosidase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCD55537.1|GH53	2.81e-255	1	349	1	349
ATZ53002.1|GH53	2.81e-255	1	349	1	349
APA11338.1|GH53	6.69e-238	1	349	1	349
QSZ36960.1|GH53	4.96e-194	1	349	1	349
QGA22233.1|GH53	7.74e-171	6	349	9	353

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1HJS_A	2.77e-162	17	346	1	329	Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJS_B Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJS_C Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJS_D Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_A Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_B Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_C Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_D Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus]
1FHL_A	1.19e-154	17	334	1	318	Crystal Structure Of Beta-1,4-galactanase From Aspergillus Aculeatus At 293k [Aspergillus aculeatus],1FOB_A Crystal Structure Of Beta-1,4-galactanase From Aspergillus Aculeatus At 100k [Aspergillus aculeatus],6Q3R_A ASPERGILLUS ACULEATUS GALACTANASE [Aspergillus aculeatus],6Q3R_B ASPERGILLUS ACULEATUS GALACTANASE [Aspergillus aculeatus]
1HJQ_A	3.67e-153	17	346	1	329	Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Humicola insolens]
4BF7_A	3.38e-144	16	346	17	347	Emericilla nidulans endo-beta-1,4-galactanase [Aspergillus nidulans]
1R8L_A	1.28e-41	21	318	26	325	The structure of endo-beta-1,4-galactanase from Bacillus licheniformis [Bacillus licheniformis],1R8L_B The structure of endo-beta-1,4-galactanase from Bacillus licheniformis [Bacillus licheniformis],1UR0_A The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],1UR0_B The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],1UR4_A The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],1UR4_B The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],2CCR_A Structure of Beta-1,4-Galactanase [Bacillus licheniformis],2CCR_B Structure of Beta-1,4-Galactanase [Bacillus licheniformis],2J74_A Structure of Beta-1,4-Galactanase [Bacillus licheniformis],2J74_B Structure of Beta-1,4-Galactanase [Bacillus licheniformis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P83692|GANA_THETO	1.43e-161	17	346	1	329	Arabinogalactan endo-beta-1,4-galactanase OS=Thermothelomyces thermophilus OX=78579 PE=1 SV=1
sp|P48842|GANA_ASPAC	2.65e-154	16	334	16	334	Arabinogalactan endo-beta-1,4-galactanase OS=Aspergillus aculeatus OX=5053 GN=gal1 PE=1 SV=1
sp|Q4WJ80|GANA_ASPFU	6.60e-154	16	349	21	356	Probable arabinogalactan endo-beta-1,4-galactanase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=galA PE=3 SV=2
sp|B0XPR3|GANA_ASPFC	1.88e-153	16	349	21	356	Probable arabinogalactan endo-beta-1,4-galactanase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=galA PE=3 SV=2
sp|Q9Y7F8|GANA_ASPTU	2.17e-153	16	334	16	334	Probable arabinogalactan endo-beta-1,4-galactanase A OS=Aspergillus tubingensis OX=5068 GN=galA PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000245	0.999723	CS pos: 16-17. Pr: 0.9808

TMHMM  Annotations     

There is no transmembrane helices in Bcin08g06160.1:RNA-p1.