CAZyme Information: Bcin08g06000.1:RNA-p1

Basic Information

• Species: Botrytis cinerea
• Lineage: Ascomycota; Leotiomycetes; ; Sclerotiniaceae; Botrytis; Botrytis cinerea
• CAZyme ID: Bcin08g06000.1:RNA-p1
• CAZy Family: GH31
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
428		49616.59	4.6396

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_BcinereaB05-10	12073	332648	366	11707

• Gene Location: location=bcin_chr_8:2237513-2238850(-)

Full Sequence      

MYRQISCQYQTFFLSFITIFLLIIVAIQHEEISNKRKLTISMKSSNSSVVISAPLATYSS
EAPGFPRKLWYKVGPQGVSDEAKRFRHHCLDINPGYKYEVLTDAFADEYVWKWFSHRPDI
LNTYFSLNIPILKADLLRYLILYADGGVWFDLDVSCEDTPIDNWVLAEHRAANLVVGLEF
DYDYQEDTAMYSQFASWTIMAKPRSPHLMQVIHDILDELNEIAKRNDVSIEGIELSMISD
VVDITGPKRMTWGIIKSLKEILGRELDDRDVGELRSARLIHDVLILPGNAFAGTQNGFKK
EKGKVFVNHHYAGMWKNKFGGEAEKGSEKEKEIEEEKRIEQEMEEKKTEEERTEQERMEQ
EQKDTEQEHETEEGNGNEQSKNVEDEKEGKESKQQETSEHGKKIKENNDTEDKEAKEKED
PEQEKENL

Enzyme Prediction     

No EC number prediction in Bcin08g06000.1:RNA-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	85	165	4.8e-17	0.9

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	1.79e-16	58	214	76	241	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	7.07e-13	89	164	11	86	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.
226920	CobT2	2.69e-04	363	427	228	294	Cobalamin biosynthesis protein CobT (nicotinate-mononucleotide:5, 6-dimethylbenzimidazole phosphorib... [Coenzyme transport and metabolism].
273344	2A1904	0.005	360	426	816	882	K+-dependent Na+/Ca+ exchanger. [Transport and binding proteins, Cations and iron carrying compounds]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATZ52986.1|GT32	2.17e-260	1	428	1	428
CCD55512.1|GT32	1.80e-252	1	428	1	428
QSZ36955.1|GT32	1.93e-142	4	326	5	333
ATZ57770.1|GT32	8.63e-134	40	327	52	338
CCD47241.1|GT32	8.63e-134	40	327	52	338

PDB Hits     

Bcin08g06000.1:RNA-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9UTR6|OCH1_SCHPO	2.65e-26	46	317	120	395	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|Q5A4E3|OCH1_CANAL	8.60e-24	61	317	95	377	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|P47124|HOC1_YEAST	9.34e-20	65	317	130	389	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3
sp|P31755|OCH1_YEAST	1.41e-12	58	215	90	282	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1
sp|P33300|SUR1_YEAST	1.00e-10	66	157	56	144	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.784738	0.215267

TMHMM  Annotations     

Start	End
12	29