CAZyme Information: Bcin08g04900.1:RNA-p1

Basic Information

• Species: Botrytis cinerea
• Lineage: Ascomycota; Leotiomycetes; ; Sclerotiniaceae; Botrytis; Botrytis cinerea
• CAZyme ID: Bcin08g04900.1:RNA-p1
• CAZy Family: GH31
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
620		67729.43	5.4231

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_BcinereaB05-10	12073	332648	366	11707

• Gene Location: location=bcin_chr_8:1877804-1879720(+)

Full Sequence      

MSLGNKDENTFDVIIVGGGTAGSVLAARLSSTPTLRILVLEAGQNRNSDPKVSTPGFAGS
VFGNQNYDWGFRTVSEKGLNGRVILQPRGKLWGGSSAINSHALVYPSSAYHDAWGSLLGA
GKGWDWDGIGKYYTRFQKLQEPGEEVKRELEIGDFAMEGGHIRKHDESEYEEVIQASYPV
TLHPMQKAWTDAIQDLGYSSSKNPVEGDVLGGSTTTNAIDSFRGERSHAGVAFLEPSIKR
GNLVVKSNVLVNKIIFGEEKRDGKVVAIGVLYSQENGETVIAHASREVVVCAGTFGSPKL
LELSGIGQRERLNTAGIECLRELGGVGENLQDHLNFGPSVEVLDNIETADVAARDPSIIE
AAKKLYEAKHTGRFAEGAAYSFSYLPLKFFNSEEEERELTALVNKTLLESSSTVSKGLKA
QYDIIKRIIFDPEEASSTIFMTRKQRYTPIATPAPGNYMTILAMLSYPFSRGSSHIATAD
PIEHPEIKINYLEHPLDAEMLSRHIIQIGQLLEQPKLSALLKPDGNTLPSGFPRHTKSVE
EVTRFIRQFGATNYHPVGTCAMMSEDLDGVVDENLIVYGTANMRVCDASVIPIEPRGNVL
STVYATAEKGADILKRDLEF

Enzyme Prediction     

No EC number prediction in Bcin08g04900.1:RNA-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	10	616	3.4e-165	0.9947183098591549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	8.71e-88	8	617	3	535	choline dehydrogenase; Validated
225186	BetA	6.21e-86	8	617	5	536	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	5.41e-36	468	609	1	142	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	1.51e-24	80	334	15	217	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	3.04e-24	5	618	50	581	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATZ52868.1|AA3_2	0.0	1	620	1	620
QRC94714.1|AA3_2	1.12e-166	5	614	5	601
QSZ30689.1|AA3_2	1.72e-145	1	617	1	595
QKX63165.1|AA3_2	1.95e-135	7	615	10	608
ANH22750.1|AA3_2	7.81e-129	1	618	34	645

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4YNT_A	6.58e-59	7	617	2	567	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
6ZE2_A	1.43e-58	8	617	3	585	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
5OC1_A	1.56e-58	11	617	2	564	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	8.09e-58	11	617	3	565	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
5ZU3_A	8.95e-55	7	617	3	572	Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_B Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_C Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A2H3D1U1|ARMD5_ARMGA	5.48e-87	8	618	37	633	Dehydrogenase ARMGADRAFT_1018426 OS=Armillaria gallica OX=47427 GN=ARMGADRAFT_1018426 PE=1 SV=1
sp|A0A5C1RDA6|ASC9_DIDFA	2.11e-78	8	617	11	619	Dehydrogenase OS=Didymella fabae OX=372025 GN=orf9 PE=3 SV=1
sp|Q5GMY3|GMCH_MALSM	1.51e-76	7	614	43	615	GMC oxidoreductase family protein Mala s 12.0101 OS=Malassezia sympodialis OX=76777 PE=1 SV=2
sp|M5EAX2|GMCH_MALS4	1.51e-76	7	614	43	615	GMC oxidoreductase family protein Mala s 12 OS=Malassezia sympodialis (strain ATCC 42132) OX=1230383 GN=MSY001_2108 PE=1 SV=1
sp|A0A142PTM2|CITC_MONPU	3.21e-76	8	620	11	614	Dehydrogenase mpl7 OS=Monascus purpureus OX=5098 GN=mpl7 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000031	0.000032

TMHMM  Annotations     

There is no transmembrane helices in Bcin08g04900.1:RNA-p1.