CAZyme Information: Bcin08g04280.1:RNA-p1

Basic Information

• Species: Botrytis cinerea
• Lineage: Ascomycota; Leotiomycetes; ; Sclerotiniaceae; Botrytis; Botrytis cinerea
• CAZyme ID: Bcin08g04280.1:RNA-p1
• CAZy Family: GH3
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
381	bcin_chr_8|CGC5	41597.43	4.2638

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_BcinereaB05-10	12073	332648	366	11707

• Gene Location: location=bcin_chr_8:1638712-1639912(-)

Full Sequence      

MRVLNMRFILPIVLSFAGHATADCECGYSSSIGDSVEPYIFTDLIESDFLHIPNITLDTD
WRRQQFNMSAAAGRGPYGMNYSIEQVTSNPIPDENTWSGEGEFGIDPGVQLTVSGGDPAN
GFVQTAEMDSAREDLLWGTYRAAMKLTLTPGTCAAFFWYFNDSQEIDMEFLSSQFNVDNN
TFPVNLVLQSVQSVQAGYNAAVTGNYIVANLPFNPTTGYHEYRIDFIPGNVIFYADGQIL
AKMNSTAVPTSPGHMIITQWSNGNPLWSSGPPSHDAVISVSYVKAYFNSSDPVREIGLIK
RCKDSSAENAICAIPDQTSAPNPDGNNGNASARTFFFSNQKNETNNQTVYKKSEATTATT
VGPYGSISLFLLLSMIATILL

Enzyme Prediction     

No EC number prediction in Bcin08g04280.1:RNA-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	99	286	9.2e-86	0.96875

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185683	Glyco_hydrolase_16	7.18e-37	116	286	46	210	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
185684	GH16_lichenase	4.84e-09	88	282	20	205	lichenase, member of glycosyl hydrolase family 16. Lichenase, also known as 1,3-1,4-beta-glucanase, is a member of glycosyl hydrolase family 16, that specifically cleaves 1,4-beta-D-glucosidic bonds in mixed-linked beta glucans that also contain 1,3-beta-D-glucosidic linkages. Natural substrates of beta-glucanase are beta-glucans from grain endosperm cell walls or lichenan from the Islandic moss, Cetraria islandica. This protein is found not only in bacteria but also in anaerobic fungi. This domain includes two seven-stranded antiparallel beta-sheets that are adjacent to one another forming a compact, jellyroll beta-sandwich structure.
395585	Glyco_hydro_16	1.89e-06	136	265	32	155	Glycosyl hydrolases family 16.
225182	BglS	1.24e-05	132	293	113	272	Beta-glucanase, GH16 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCD51958.2|GH16_23	3.73e-283	1	381	1	381
ATZ52796.1|GH16_23	3.73e-283	1	381	1	381
ATZ52797.1|GH16_23	3.73e-283	1	381	1	381
APA11129.1|GH16_23	1.41e-246	1	381	1	381
QSZ37303.1|GH16_23	6.80e-238	1	381	1	381

PDB Hits     

Bcin08g04280.1:RNA-p1 has no PDB hit.

Swiss-Prot Hits     

Bcin08g04280.1:RNA-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000243	0.999741	CS pos: 22-23. Pr: 0.9702

TMHMM  Annotations     

There is no transmembrane helices in Bcin08g04280.1:RNA-p1.