CAZyme Information: Bcin08g02970.1:RNA-p1

Basic Information

• Species: Botrytis cinerea
• Lineage: Ascomycota; Leotiomycetes; ; Sclerotiniaceae; Botrytis; Botrytis cinerea
• CAZyme ID: Bcin08g02970.1:RNA-p1
• CAZy Family: GH3
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
346		37236.20	6.7166

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_BcinereaB05-10	12073	332648	366	11707

• Gene Location: location=bcin_chr_8:1125159-1126380(+)

Full Sequence      

MYSLIPILSFAATLLGAVSAAPLEARAVSRTSAPSGAVIVDATGKTAGSYTTFQKGVNAL
STTTTTPQYLFIYPGTYTEQVYVPALNSNLTIQGYTTDASTYAGNQVTLTYNLALKDTTS
DDLTATLRQWNKNTKVYNLIIQNTFGHISSNGQNLAISAHTTNQGYYATQFIGYQDTILA
NTGTQLYAKCLVVGAIDFIFGQTAQAWFENNDIRTIAAGSITASGRADDSNPSWYVINNS
NIQNINSSVATGNNYLGRPWRNYARVVFQNSYLGNNIKAAGWSVWSSSTANTDHVVFEEY
GNTGPGSNSSGVQRATFSSGISKAIPITTVLGSAYLNEWWVDSSYL

Enzyme Prediction     

EC	3.1.1.11:3	3.2.1.15:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	40	314	6.4e-68	0.9166666666666666

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395871	Pectinesterase	1.70e-33	38	311	2	270	Pectinesterase.
178051	PLN02432	3.81e-33	38	329	13	282	putative pectinesterase
178372	PLN02773	3.16e-31	32	318	1	279	pectinesterase
178113	PLN02497	1.78e-28	38	310	34	297	probable pectinesterase
215117	PLN02176	1.62e-27	38	310	41	304	putative pectinesterase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATZ52640.1|CE8	8.93e-246	1	346	1	346
CAC29255.1|CE8|3.1.1.11	8.93e-246	1	346	1	346
CCD53974.1|CE8	8.93e-246	1	346	1	346
APA11010.1|CE8	1.09e-202	1	346	1	344
QSZ37098.1|CE8	7.64e-185	5	346	4	346

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5C1E_A	4.51e-59	29	345	2	299	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
5C1C_A	2.51e-58	29	345	2	299	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
1GQ8_A	7.08e-25	38	311	9	277	Pectin methylesterase from Carrot [Daucus carota]
1XG2_A	1.48e-21	48	310	13	272	Chain A, Pectinesterase 1 [Solanum lycopersicum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P17872|PME_ASPNG	4.48e-90	25	346	15	330	Pectinesterase OS=Aspergillus niger OX=5061 GN=pme1 PE=1 SV=1
sp|Q12535|PME_ASPAC	3.60e-89	23	345	13	330	Pectinesterase OS=Aspergillus aculeatus OX=5053 GN=pme1 PE=2 SV=1
sp|A2QK82|PMEA_ASPNC	3.61e-58	29	345	30	327	Probable pectinesterase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=pmeA PE=3 SV=1
sp|B8NPS7|PMEA_ASPFN	5.68e-56	19	345	17	324	Probable pectinesterase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=pmeA PE=3 SV=1
sp|Q5B7U0|PMEA_EMENI	8.21e-56	13	345	11	325	Pectinesterase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pmeA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000260	0.999692	CS pos: 26-27. Pr: 0.8837

TMHMM  Annotations     

There is no transmembrane helices in Bcin08g02970.1:RNA-p1.