CAZyme Information: Bcin08g02090.1:RNA-p1

Basic Information

• Species: Botrytis cinerea
• Lineage: Ascomycota; Leotiomycetes; ; Sclerotiniaceae; Botrytis; Botrytis cinerea
• CAZyme ID: Bcin08g02090.1:RNA-p1
• CAZy Family: GH3
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
555		59251.14	5.9512

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_BcinereaB05-10	12073	332648	366	11707

• Gene Location: location=bcin_chr_8:792357-794193(-)

Full Sequence      

MQIPIEVDYIIVGGGLTGCALASHLSKRLGPSASILVLEAGPDPTSNPNSASLGGGFALA
GSELDWSYKTTPISSISNRVITLNAGKTLGGSSILNYGGWARGDTSDYDAWTRMLDDKRW
SYNGLLPYFRGSEAFNDAGANSEQYGSNGPMKVKSISGSDPKRKYPLREPLLKAWKEIGV
ERVPSNAGKLAGLSEFLENFDDGVRQPSHLAYDLSGVQVKTEALVHRINFEQVPNQEPRA
IGVLLADGRQIKARKEIIIAAGAVRSPQLLQLSGVGPASVISRHGIPVIYDSPAVGQNLF
DHFALFQVYKLRDPERGLSLGHPSLADPAFFKGMPVDWIVNEALPADQLKKALTEDGDPS
DSHGLDDASRTHVETMVVYNPLAPGVPVNGSFIATSVMLTLPTSRGSLELASASPNEPPI
IRPNYFSTAVDRAVLIHGVRRLLQALTFTQAGKDVVESEMSPGPGLSSLTLESSDKDIED
RIRAIGSPHYHMAGTCALGTVLDTELRVKGVQGLRVVDASIFPAPLGGHPQASLYAIADL
GAEMISMAKEAKDTN

Enzyme Prediction     

No EC number prediction in Bcin08g02090.1:RNA-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	8	546	3.7e-139	0.9894366197183099

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	8.72e-89	6	545	5	531	choline dehydrogenase; Validated
225186	BetA	8.95e-87	6	545	7	533	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	7.45e-38	402	538	1	140	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	6.91e-33	8	534	57	565	Protein HOTHEAD
366272	GMC_oxred_N	8.63e-30	74	302	12	216	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATZ52510.1|AA3_2	0.0	1	555	1	555
APA10650.1|AA3_2	7.00e-232	4	513	6	451
QMW27401.1|AA3_2	3.36e-210	2	545	3	550
QMW39472.1|AA3_2	3.36e-210	2	545	3	550
QRD81789.1|AA3_2	3.36e-210	2	545	3	550

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4YNT_A	3.34e-57	8	545	7	564	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
3LJP_A	5.51e-56	6	554	13	535	Chain A, Choline oxidase [Arthrobacter globiformis],3LJP_B Chain B, Choline oxidase [Arthrobacter globiformis]
2JBV_A	7.64e-56	6	554	13	535	Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],2JBV_B Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],4MJW_A Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis],4MJW_B Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis]
3NNE_A	7.64e-56	6	554	13	535	Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_B Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_C Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_D Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_E Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_F Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_G Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_H Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis]
3Q9T_A	4.71e-53	8	545	8	569	Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_B Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_C Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A1L9WN49|ACUG_ASPA1	8.13e-116	8	545	6	518	GMC-type oxidoreductase acuG OS=Aspergillus aculeatus (strain ATCC 16872 / CBS 172.66 / WB 5094) OX=690307 GN=acuG PE=3 SV=1
sp|Q988C9|4PADH_RHILO	2.47e-64	8	552	8	540	4-pyridoxate dehydrogenase OS=Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099) OX=266835 GN=padh1 PE=1 SV=1
sp|Q5B8A1|PKFF_EMENI	9.93e-60	8	545	42	607	Dehydrogenase pkfF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pkfF PE=2 SV=1
sp|P64264|Y1310_MYCBO	3.86e-56	6	545	4	526	Uncharacterized GMC-type oxidoreductase Mb1310 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) OX=233413 GN=BQ2027_MB1310 PE=3 SV=1
sp|P9WMV4|Y1279_MYCTO	3.86e-56	6	545	4	526	Uncharacterized GMC-type oxidoreductase MT1316 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT1316 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999962	0.000052

TMHMM  Annotations     

There is no transmembrane helices in Bcin08g02090.1:RNA-p1.