CAZyme Information: Bcin07g06700.2:RNA-p1

Basic Information

• Species: Botrytis cinerea
• Lineage: Ascomycota; Leotiomycetes; ; Sclerotiniaceae; Botrytis; Botrytis cinerea
• CAZyme ID: Bcin07g06700.2:RNA-p1
• CAZy Family: GH28
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
456		51618.75	4.7809

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_BcinereaB05-10	12073	332648	366	11707

• Gene Location: location=bcin_chr_7:2487290-2488660(+)

Full Sequence      

MSIPENLKDLKDVLRPDFHFGYATAAPQVEGAWNVDGKGISIWDKFGHTPGKVKDSSTCD
DAVLSYYKTAEDVALMKSYGVTGYRFSLSWSRIIPLGGKDDPINEKGLKYYSELVDELLK
NGITPFVTLFHWDIPQALEDRYGGMLNKEKYTPDFVRYARVCFEALGDRVKNWITYNEPG
VYTLAGYAAGVHAPGRSSNRELNEEGDSSTEPFTVGHTELVSHAYVVKMYREEFKEKQGG
TIMITLHGNYSEPWNEDDPLDVEAAERAREFEIAWFADPVYKTGDYPASIRAQLGDRLPR
FTEEESKLVLGSSDFYGMNSYTTFFVKHRDGPADINDHSGNIDKLDTNSKGVVRGPESDT
YWLRTCPDGFRKLLNWIWARYGVPIFITENGTTAKGETAPTDEVLNDKFRIDFFEGYIGA
LARAVKEDGVDIRSYFAWTFTDNWGKISRILMITCD

Enzyme Prediction     

EC	3.2.1.21:13

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	13	444	2.7e-134	0.8974358974358975

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395176	Glyco_hydro_1	2.09e-146	10	443	1	411	Glycosyl hydrolase family 1.
225343	BglB	5.76e-121	17	444	7	414	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
215455	PLN02849	5.05e-102	18	442	34	441	beta-glucosidase
215435	PLN02814	2.47e-101	17	442	31	441	beta-glucosidase
215539	PLN02998	3.13e-88	6	442	23	446	beta-glucosidase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATZ52176.1|GH1	0.0	1	456	1	456
ATZ52175.1|GH1	0.0	1	444	1	444
CCD55258.1|GH1	0.0	1	444	1	444
EGX51900.1|GH1	7.32e-274	10	444	8	444
CAP91982.1|GH1	1.64e-270	6	444	5	444

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4MDO_A	2.43e-168	14	444	26	456	Chain A, Beta-glucosidase [[Humicola] grisea var. thermoidea],4MDP_A Chain A, Beta-glucosidase [[Humicola] grisea var. thermoidea]
6EFU_A	3.42e-165	13	444	2	423	Crystal structure of the double mutant L167W / P172L of the beta-glucosidase from Trichoderma harzianum [Trichoderma harzianum],6EFU_B Crystal structure of the double mutant L167W / P172L of the beta-glucosidase from Trichoderma harzianum [Trichoderma harzianum]
5JBK_A	6.87e-165	13	444	2	423	Trichoderma harzianum GH1 beta-glucosidase ThBgl1 [Trichoderma harzianum],5JBK_B Trichoderma harzianum GH1 beta-glucosidase ThBgl1 [Trichoderma harzianum]
5BWF_A	1.31e-164	13	444	21	442	Crystal structure of the beta-glucosidase from Trichoderma harzianum [Trichoderma harzianum],5BWF_B Crystal structure of the beta-glucosidase from Trichoderma harzianum [Trichoderma harzianum]
3AHY_A	1.07e-160	13	444	8	430	Chain A, Beta-glucosidase [Trichoderma reesei],3AHY_B Chain B, Beta-glucosidase [Trichoderma reesei],3AHY_C Chain C, Beta-glucosidase [Trichoderma reesei],3AHY_D Chain D, Beta-glucosidase [Trichoderma reesei]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q25BW4|BGL1B_PHACH	3.17e-160	14	449	11	445	Beta-glucosidase 1B OS=Phanerodontia chrysosporium OX=2822231 GN=BGL1B PE=1 SV=1
sp|Q25BW5|BGL1A_PHACH	8.55e-149	14	444	6	421	Beta-glucosidase 1A OS=Phanerodontia chrysosporium OX=2822231 GN=BGL1A PE=1 SV=1
sp|Q8L7J2|BGL06_ORYSJ	4.56e-120	18	444	54	483	Beta-glucosidase 6 OS=Oryza sativa subsp. japonica OX=39947 GN=BGLU6 PE=1 SV=1
sp|Q339X2|BGL34_ORYSJ	6.52e-120	18	444	42	471	Beta-glucosidase 34 OS=Oryza sativa subsp. japonica OX=39947 GN=BGLU34 PE=2 SV=1
sp|Q9FZE0|BGL40_ARATH	1.30e-119	18	444	41	470	Beta-glucosidase 40 OS=Arabidopsis thaliana OX=3702 GN=BGLU40 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000083	0.000000

TMHMM  Annotations     

There is no transmembrane helices in Bcin07g06700.2:RNA-p1.