CAZyme Information: Bcin07g06700.1:RNA-p1

Basic Information

• Species: Botrytis cinerea
• Lineage: Ascomycota; Leotiomycetes; ; Sclerotiniaceae; Botrytis; Botrytis cinerea
• CAZyme ID: Bcin07g06700.1:RNA-p1
• CAZy Family: GH28
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
488	bcin_chr_7|CGC9	55423.02	4.9830

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_BcinereaB05-10	12073	332648	366	11707

• Gene Location: location=bcin_chr_7:2487290-2488806(+)

Full Sequence      

MSIPENLKDLKDVLRPDFHFGYATAAPQVEGAWNVDGKGISIWDKFGHTPGKVKDSSTCD
DAVLSYYKTAEDVALMKSYGVTGYRFSLSWSRIIPLGGKDDPINEKGLKYYSELVDELLK
NGITPFVTLFHWDIPQALEDRYGGMLNKEKYTPDFVRYARVCFEALGDRVKNWITYNEPG
VYTLAGYAAGVHAPGRSSNRELNEEGDSSTEPFTVGHTELVSHAYVVKMYREEFKEKQGG
TIMITLHGNYSEPWNEDDPLDVEAAERAREFEIAWFADPVYKTGDYPASIRAQLGDRLPR
FTEEESKLVLGSSDFYGMNSYTTFFVKHRDGPADINDHSGNIDKLDTNSKGVVRGPESDT
YWLRTCPDGFRKLLNWIWARYGVPIFITENGTTAKGETAPTDEVLNDKFRIDFFEGYIGA
LARAVKEDGVDIRSYFAWTFTDNWEWAAGFTDRFGVTFIDFESKEKKRYPKRSATVIKSL
FTHMIEGK

Enzyme Prediction     

EC	3.2.1.21:13

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	13	482	3.4e-148	0.9813519813519813

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395176	Glyco_hydro_1	4.78e-159	10	482	1	449	Glycosyl hydrolase family 1.
225343	BglB	3.10e-132	17	483	7	452	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
215435	PLN02814	3.43e-110	17	475	31	474	beta-glucosidase
215455	PLN02849	6.07e-109	18	474	34	473	beta-glucosidase
215539	PLN02998	1.53e-96	6	474	23	478	beta-glucosidase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATZ52175.1|GH1	0.0	1	488	1	488
CCD55258.1|GH1	0.0	1	488	1	488
ATZ52176.1|GH1	0.0	1	444	1	444
EGX51900.1|GH1	1.31e-296	10	485	8	485
CAP91982.1|GH1	5.92e-293	6	486	5	486

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4MDO_A	1.69e-184	14	485	26	496	Chain A, Beta-glucosidase [[Humicola] grisea var. thermoidea],4MDP_A Chain A, Beta-glucosidase [[Humicola] grisea var. thermoidea]
6EFU_A	1.34e-180	13	485	2	463	Crystal structure of the double mutant L167W / P172L of the beta-glucosidase from Trichoderma harzianum [Trichoderma harzianum],6EFU_B Crystal structure of the double mutant L167W / P172L of the beta-glucosidase from Trichoderma harzianum [Trichoderma harzianum]
5JBK_A	2.69e-180	13	485	2	463	Trichoderma harzianum GH1 beta-glucosidase ThBgl1 [Trichoderma harzianum],5JBK_B Trichoderma harzianum GH1 beta-glucosidase ThBgl1 [Trichoderma harzianum]
5BWF_A	5.21e-180	13	485	21	482	Crystal structure of the beta-glucosidase from Trichoderma harzianum [Trichoderma harzianum],5BWF_B Crystal structure of the beta-glucosidase from Trichoderma harzianum [Trichoderma harzianum]
3AHY_A	1.05e-176	13	485	8	470	Chain A, Beta-glucosidase [Trichoderma reesei],3AHY_B Chain B, Beta-glucosidase [Trichoderma reesei],3AHY_C Chain C, Beta-glucosidase [Trichoderma reesei],3AHY_D Chain D, Beta-glucosidase [Trichoderma reesei]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q25BW4|BGL1B_PHACH	4.93e-173	14	487	11	478	Beta-glucosidase 1B OS=Phanerodontia chrysosporium OX=2822231 GN=BGL1B PE=1 SV=1
sp|Q25BW5|BGL1A_PHACH	9.12e-162	14	486	6	461	Beta-glucosidase 1A OS=Phanerodontia chrysosporium OX=2822231 GN=BGL1A PE=1 SV=1
sp|Q339X2|BGL34_ORYSJ	4.87e-134	18	480	42	505	Beta-glucosidase 34 OS=Oryza sativa subsp. japonica OX=39947 GN=BGLU34 PE=2 SV=1
sp|Q8L7J2|BGL06_ORYSJ	5.52e-133	18	480	54	518	Beta-glucosidase 6 OS=Oryza sativa subsp. japonica OX=39947 GN=BGLU6 PE=1 SV=1
sp|Q9FZE0|BGL40_ARATH	2.50e-131	18	473	41	498	Beta-glucosidase 40 OS=Arabidopsis thaliana OX=3702 GN=BGLU40 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000083	0.000000

TMHMM  Annotations     

There is no transmembrane helices in Bcin07g06700.1:RNA-p1.