CAZyme Information: Bcin07g05530.2:RNA-p1

Basic Information

• Species: Botrytis cinerea
• Lineage: Ascomycota; Leotiomycetes; ; Sclerotiniaceae; Botrytis; Botrytis cinerea
• CAZyme ID: Bcin07g05530.2:RNA-p1
• CAZy Family: GH28
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
483		55236.76	4.6791

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_BcinereaB05-10	12073	332648	366	11707

• Gene Location: location=bcin_chr_7:2037684-2039184(+)

Full Sequence      

MGLKEDFEIAVRSIEGIDFTTTEQNDINVFETTIRYMGGFLAAYDMSGAKYPVLLLKAVE
VAELLMSCFDTPNRMPIPRWDWKKYLEGEDQLAPRRVLVSEPGSLSLEFTRLSQLTGNSK
YYDAVQRISDEFEKSQNSTRYPGLWPVSIDLQKLRFDEDTMFTMGGMSDSTYEYLPKQYM
VLGGVLDQPKKMYESFISVAQETMFFPILNEKNQKIRVSGDVRTKGIAESSTPELIPRGQ
HLTCFTGGMIGIASKIFDRPSDLALAEELTNGCIWAYDNSPNGIAPEIFSVVPCPKDHDC
TYSKQKWYDALAAVYTHPITHTEEETEKKLKEIIEERRLSPGFTAVDDRRYILRPEAIES
VWILWRITGDRKYMDAAWRMFQAIEKICRTEIASAAILDVTVKAVVGGEGKGKNGNRKQE
DRFAHELDETNGEEGVEQADSMESFWLAETLKYFYLVFSEWDVVSLDEWVLNTEAHPLKR
LKR

Enzyme Prediction     

EC	3.2.1.113:7

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH47	1	480	4.6e-135	0.8923766816143498

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396217	Glyco_hydro_47	1.42e-173	1	480	47	453	Glycosyl hydrolase family 47. Members of this family are alpha-mannosidases that catalyze the hydrolysis of the terminal 1,2-linked alpha-D-mannose residues in the oligo-mannose oligosaccharide Man(9)(GlcNAc)(2).
240427	PTZ00470	8.31e-95	1	482	124	520	glycoside hydrolase family 47 protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATZ52024.1|GH47	0.0	1	483	1	483
ATZ52025.1|GH47	0.0	1	483	151	633
CCD55433.1|GH47	0.0	1	483	151	633
APA05278.1|GH47	9.52e-289	1	482	151	651
CAY09754.1|GH47	1.91e-185	1	480	165	618

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5KIJ_A	1.35e-46	1	478	57	449	Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase and Man9GlcNAc2-PA complex [Homo sapiens]
1FMI_A	1.52e-46	1	478	62	454	Crystal Structure Of Human Class I Alpha1,2-Mannosidase [Homo sapiens]
1FO2_A	1.58e-46	1	478	62	454	Crystal Structure Of Human Class I Alpha1,2-Mannosidase In Complex With 1-Deoxymannojirimycin [Homo sapiens],1FO3_A Crystal Structure Of Human Class I Alpha1,2-Mannosidase In Complex With Kifunensine [Homo sapiens]
1X9D_A	6.16e-46	1	478	140	532	Crystal Structure Of Human Class I alpha-1,2-Mannosidase In Complex With Thio-Disaccharide Substrate Analogue [Homo sapiens]
5KK7_A	7.37e-46	1	478	57	449	Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase T688A mutant and Thio-disaccharide substrate analog complex [Homo sapiens],5KK7_B Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase T688A mutant and Thio-disaccharide substrate analog complex [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O18498|MA1A1_SPOFR	2.48e-49	1	477	254	641	Mannosyl-oligosaccharide alpha-1,2-mannosidase IA OS=Spodoptera frugiperda OX=7108 PE=1 SV=1
sp|Q8H116|MNS2_ARATH	1.58e-47	1	479	151	536	Mannosyl-oligosaccharide 1,2-alpha-mannosidase MNS2 OS=Arabidopsis thaliana OX=3702 GN=MNS2 PE=1 SV=1
sp|P39098|MA1A2_MOUSE	2.13e-47	1	482	237	628	Mannosyl-oligosaccharide 1,2-alpha-mannosidase IB OS=Mus musculus OX=10090 GN=Man1a2 PE=1 SV=1
sp|O60476|MA1A2_HUMAN	4.03e-47	1	478	237	624	Mannosyl-oligosaccharide 1,2-alpha-mannosidase IB OS=Homo sapiens OX=9606 GN=MAN1A2 PE=1 SV=1
sp|Q12563|MNS1B_ASPPH	8.15e-47	17	479	111	509	Mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus phoenicis OX=5063 GN=mns1B PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000056	0.000000

TMHMM  Annotations     

There is no transmembrane helices in Bcin07g05530.2:RNA-p1.