CAZyme Information: Bcin07g03280.1:RNA-p1

Basic Information

• Species: Botrytis cinerea
• Lineage: Ascomycota; Leotiomycetes; ; Sclerotiniaceae; Botrytis; Botrytis cinerea
• CAZyme ID: Bcin07g03280.1:RNA-p1
• CAZy Family: GH27
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
402	bcin_chr_7|CGC2	44360.00	4.9803

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_BcinereaB05-10	12073	332648	366	11707

• Gene Location: location=bcin_chr_7:1181121-1182469(-)

Full Sequence      

MGGWMDRYKGWEILVMSWLFSMWFALLFCLGIGITDKMRVSKYSVPLFTGYGLSTAMPDA
SKTDLASSAQKHGWIPRFENLVAFGDSYTDESRLSYFQTHNGSAPPPGTLLPSSNSTAGG
GVTWDRWVSNYSGAKLYDYAVAGAVCSNAIINRYLASISGPFPDVVYEVDAFTADVKYIN
SSTNTNTLYTNRKPDNTVYSMWIGTNDLGEGAFLTDSSLNGATIPDYVDCIFDRFDGIYQ
TGARYFVLMNNAPLQLTPLYGMPGAGGLNASHYWPNKPSNISEISGKMKEYTQLANSIFD
YRVPFEIVIKKRYPGASIAVFDTNSLLTDIYNNPTQYLPAPAVVDASYVLCAVSGSPCPK
QPGSLDGYMWYDELHPSQGTDKVIAQEFLNVVKGNSKYATYW

Enzyme Prediction     

No EC number prediction in Bcin07g03280.1:RNA-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE16	81	388	5.9e-66	0.9925093632958801

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238882	fatty_acyltransferase_like	1.76e-46	80	391	1	270	Fatty acyltransferase-like subfamily of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases. Might catalyze fatty acid transfer between phosphatidylcholine and sterols.
225780	COG3240	1.29e-12	76	391	27	332	Phospholipase/lecithinase/hemolysin [Lipid transport and metabolism, General function prediction only].
238883	Triacylglycerol_lipase_like	2.56e-12	78	391	1	280	Triacylglycerol lipase-like subfamily of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases. Members of this subfamily might hydrolyze triacylglycerol into diacylglycerol and fatty acid anions.
238875	SGNH_plant_lipase_like	5.96e-10	198	390	131	313	SGNH_plant_lipase_like, a plant specific subfamily of the SGNH-family of hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
395531	Lipase_GDSL	0.001	81	388	1	224	GDSL-like Lipase/Acylhydrolase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATZ51743.1|CE16	4.06e-309	1	402	1	402
CCD46398.1|CE16	1.71e-295	16	402	1	387
APA05712.1|CE16	5.05e-230	38	402	1	365
QSZ33601.1|CE16	1.60e-213	38	402	1	359
VDB86350.1|CE16	1.58e-147	73	402	31	360

PDB Hits     

Bcin07g03280.1:RNA-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A7J2C6|AES1_HYPJE	4.41e-101	78	402	27	345	Acetylesterase OS=Hypocrea jecorina OX=51453 GN=aes1 PE=1 SV=1
sp|T2FKR1|AES1_THETO	1.64e-11	81	395	34	300	Acetylesterase OS=Thermothelomyces thermophilus OX=78579 GN=aes1 PE=1 SV=1
sp|G2QJ27|AES1_MYCTT	3.99e-11	81	395	34	300	Acetylesterase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=aes1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000069	0.000000

TMHMM  Annotations     

Start	End
13	35