CAZyme Information: Bcin07g00890.1:RNA-p1

Basic Information

• Species: Botrytis cinerea
• Lineage: Ascomycota; Leotiomycetes; ; Sclerotiniaceae; Botrytis; Botrytis cinerea
• CAZyme ID: Bcin07g00890.1:RNA-p1
• CAZy Family: GH17
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
422	bcin_chr_7|CGC5	44323.21	3.7980

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_BcinereaB05-10	12073	332648	366	11707

• Gene Location: location=bcin_chr_7:318300-319783(-)

Full Sequence      

MPSLSALAPLAGIIASIPSVMAGFDPTSQSNVAVYWGQNSYGQGSGAYVQQRLSYYCQNT
EINIIPLAFLSSINTPVLNFANQGDPCTVISGSTLFYCSELEADITTCQKTYGKTIMLSV
GGATYTEGGFTSTQAATTAANNLWSWFGPDTSGDIRPFGSAVIDGFDFDFESTVSNMPTF
ANQLRSLMDTDTTKTWLLSAAPQCPYPDAADGPMLDGTVAFDIVWVQFYNNYCGVQSFVS
SASIQNNFNFDTWDNWAKTVSLNPNVKVMLGIPSNTGAGAGYTSGAALASVIAYSKSFSS
FGGIMMWDMSQLYANPGFLDAVNADLGKPAVTVPVTTTTITSTVTSTTTTTTTSTTTSAT
TTSPGSTLTTITTTSASPTSTGGSLVNEWNQCGGQGWNGGTVCVAGTSCVAYSIWYSQCN
PN

Enzyme Prediction     

EC	3.2.1.14:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	30	282	6.4e-26	0.6790540540540541

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
119356	GH18_hevamine_XipI_class_III	8.32e-98	30	324	1	280	This conserved domain family includes xylanase inhibitor Xip-I, and the class III plant chitinases such as hevamine, concanavalin B, and PPL2, all of which have a glycosyl hydrolase family 18 (GH18) domain. Hevamine is a class III endochitinase that hydrolyzes the linear polysaccharide chains of chitin and peptidoglycan and is important for defense against pathogenic bacteria and fungi. PPL2 (Parkia platycephala lectin 2) is a class III chitinase from Parkia platycephala seeds that hydrolyzes beta(1-4) glycosidic bonds linking 2-acetoamido-2-deoxy-beta-D-glucopyranose units in chitin.
395573	Glyco_hydro_18	1.30e-10	31	308	1	261	Glycosyl hydrolases family 18.
395595	CBM_1	3.26e-09	389	416	2	29	Fungal cellulose binding domain.
197593	fCBD	1.71e-08	388	419	2	33	Fungal-type cellulose-binding domain. Small four-cysteine cellulose-binding domain of fungi
119350	GH18_chitinase_D-like	2.17e-07	63	309	29	295	GH18 domain of Chitinase D (ChiD). ChiD, a chitinase found in Bacillus circulans, hydrolyzes the 1,4-beta-linkages of N-acetylglucosamine in chitin and chitodextrins. The domain architecture of ChiD includes a catalytic glycosyl hydrolase family 18 (GH18) domain, a chitin-binding domain, and a fibronectin type III domain. The chitin-binding and fibronectin type III domains are located either N-terminal or C-terminal to the catalytic domain. This family includes exochitinase Chi36 from Bacillus cereus.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCD42678.1|CBM1|GH18	4.34e-280	1	422	1	422
ATZ51455.1|CBM1|GH18	4.34e-280	1	422	1	422
APA13982.1|CBM1|GH18	4.44e-239	1	422	1	415
QSZ29773.1|CBM1|GH18	4.19e-184	12	421	12	479
QUC17538.1|CBM1|GH18	1.09e-135	1	419	1	400

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2UY2_A	5.26e-64	25	315	1	272	ScCTS1_apo crystal structure [Saccharomyces cerevisiae],2UY3_A ScCTS1_8-chlorotheophylline crystal structure [Saccharomyces cerevisiae],2UY4_A ScCTS1_acetazolamide crystal structure [Saccharomyces cerevisiae],2UY5_A ScCTS1_kinetin crystal structure [Saccharomyces cerevisiae],4TXE_A ScCTS1 in complex with compound 5 [Saccharomyces cerevisiae]
4TX6_A	5.46e-38	29	308	1	286	AfChiA1 in complex with compound 1 [Aspergillus fumigatus A1163],4TX6_B AfChiA1 in complex with compound 1 [Aspergillus fumigatus A1163]
2XVN_A	7.43e-38	30	308	1	285	A. fumigatus chitinase A1 phenyl-methylguanylurea complex [Aspergillus fumigatus],2XVN_B A. fumigatus chitinase A1 phenyl-methylguanylurea complex [Aspergillus fumigatus],2XVN_C A. fumigatus chitinase A1 phenyl-methylguanylurea complex [Aspergillus fumigatus]
2XTK_A	7.60e-38	30	308	2	286	ChiA1 from Aspergillus fumigatus in complex with acetazolamide [Aspergillus fumigatus A1163],2XTK_B ChiA1 from Aspergillus fumigatus in complex with acetazolamide [Aspergillus fumigatus A1163],2XUC_A Natural product-guided discovery of a fungal chitinase inhibitor [Aspergillus fumigatus],2XUC_B Natural product-guided discovery of a fungal chitinase inhibitor [Aspergillus fumigatus],2XUC_C Natural product-guided discovery of a fungal chitinase inhibitor [Aspergillus fumigatus],2XVP_A ChiA1 from Aspergillus fumigatus, apostructure [Aspergillus fumigatus A1163],2XVP_B ChiA1 from Aspergillus fumigatus, apostructure [Aspergillus fumigatus A1163]
2GSJ_A	5.49e-28	32	308	3	254	cDNA cloning and 1.75A crystal structure determination of PPL2, a novel chimerolectin from Parkia platycephala seeds exhibiting endochitinolytic activity [Parkia platycephala]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q12713|CHI33_TRIHA	3.12e-110	1	324	1	319	Endochitinase 33 OS=Trichoderma harzianum OX=5544 GN=chit33 PE=1 SV=1
sp|D4B4X4|CHI33_ARTBC	1.98e-97	1	326	1	311	Class III chitinase ARB_03514 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_03514 PE=1 SV=2
sp|P29029|CHIT_YEAST	2.79e-61	24	315	21	293	Endochitinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CTS1 PE=1 SV=2
sp|P40954|CHI3_CANAL	1.69e-59	28	315	21	295	Chitinase 3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CHT3 PE=1 SV=2
sp|P40953|CHI2_CANAL	3.40e-56	19	315	11	286	Chitinase 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CHT2 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.059520	0.940447	CS pos: 22-23. Pr: 0.9057

TMHMM  Annotations     

There is no transmembrane helices in Bcin07g00890.1:RNA-p1.