CAZyme Information: Bcin07g00740.1:RNA-p1

Basic Information

• Species: Botrytis cinerea
• Lineage: Ascomycota; Leotiomycetes; ; Sclerotiniaceae; Botrytis; Botrytis cinerea
• CAZyme ID: Bcin07g00740.1:RNA-p1
• CAZy Family: GH17
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
712	bcin_chr_7|CGC16	81516.69	6.0431

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_BcinereaB05-10	12073	332648	366	11707

• Gene Location: location=bcin_chr_7:269392-272016(+)

Full Sequence      

MSNSIPTSNKEVKSSSPPTIPSPPPHHLNHNLPNPDIQENGLHALVNIQTAKDIWTFLLV
FRVFNSFLVKTFFQPDEYFQALEPAWEMAFGEGSGAWITWEWHYQLRSSLHPTLFAAAYY
LIDKPMEFVNFFPQFRAEVLAVLPNIIQAIFAAGCDYYTWKMAEKMYGLGSRTGYVTLLM
SVLSPWNWFCSTRTFSNSLETSLTITALYFWPWDMAISSGEKIKEGKKEMSTTSISKGVF
RTTETVNHLRYSLLLAGIACILRPTNLLIWFCVIMPIIMSLIPGVSPKTTKSPIPQDYII
LLREAILCGSIILIISAISDRLYFGEWTFPPYQWLHFNISQNLAVFYGKNDWHYFFSQGL
PLLLLTYLPFTILSTFKSYTPSTMPNPEFTYNLQTILTHLTGVMIFVLSTISHKEVRFIY
PLLPILLLLTAPSITSFFTRETQIPTNDSSKSKIETATIRKPLLTILILLNIALAAYTTI
IHQSAVISVNTFIRHKYETEMLDAQGIPLHSPDAYTYLKHYPASFDEHAPPSLNIDYDIK
KEENSQYAKKMMGTSQNPDWDGENGEGAIPFVGFLMPCHSTPWRSQLVYKGLGAWALGCE
PPVHLEMGQRDMYRDEADRFYDDPRRFLREEILIEGDGEGDGDGDEKKMWPRYLVGFEGV
EKDVREFYEGVAEGAQDGAGRGKKMKEIWRERNTQWIDDWRRSGDVVVWEFV

Enzyme Prediction     

No EC number prediction in Bcin07g00740.1:RNA-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT22	55	587	5e-103	0.9922879177377892

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
281842	Glyco_transf_22	7.04e-50	54	420	2	317	Alg9-like mannosyltransferase family. Members of this family are mannosyltransferase enzymes. At least some members are localized in endoplasmic reticulum and involved in GPI anchor biosynthesis.
215437	PLN02816	1.61e-40	46	630	33	486	mannosyltransferase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATZ51435.1|GT22	0.0	1	712	1	712
CCD42698.1|GT22	0.0	1	712	1	708
APA13970.1|GT22	0.0	19	712	14	722
QSZ29776.1|GT22	0.0	20	712	11	719
CDP32608.1|GT22	1.00e-173	19	710	8	628

PDB Hits     

Bcin07g00740.1:RNA-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4IB63|GPI10_GIBZE	1.53e-154	58	710	27	600	GPI mannosyltransferase 3 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GPI10 PE=3 SV=1
sp|Q4WPG0|GPI10_ASPFU	1.11e-143	51	709	51	645	GPI mannosyltransferase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gpi10 PE=3 SV=1
sp|Q2UH15|GPI10_ASPOR	1.11e-122	51	709	54	627	GPI mannosyltransferase 3 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=gpi10 PE=3 SV=1
sp|Q5BCB9|GPI10_EMENI	8.59e-108	22	709	33	565	GPI mannosyltransferase 3 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=gpi10 PE=3 SV=1
sp|Q6BH65|GPI10_DEBHA	5.03e-83	36	709	27	546	GPI mannosyltransferase 3 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / BCRC 21394 / JCM 1990 / NBRC 0083 / IGC 2968) OX=284592 GN=GPI10 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999917	0.000082

TMHMM  Annotations     

Start	End
267	286
299	318
354	376
389	411
416	438
463	485