CAZyme Information: Bcin06g03790.1:RNA-p1

Basic Information

• Species: Botrytis cinerea
• Lineage: Ascomycota; Leotiomycetes; ; Sclerotiniaceae; Botrytis; Botrytis cinerea
• CAZyme ID: Bcin06g03790.1:RNA-p1
• CAZy Family: GH15|CBM20
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
558		63792.09	6.9852

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_BcinereaB05-10	12073	332648	366	11707

• Gene Location: location=bcin_chr_6:1316291-1318075(-)

Full Sequence      

MGAYDNETLAIEELPTYSSPSPFTPGRDGSPSSSESRICKDARVTIHDAPTQSSIDEKHN
VRFSVQDELVTSPSCPQNSTTPTSISIRNAFGRCSNFIHEWTPFLLVSSYFVSSIFAYML
FPTKLLEVFWFIYNFTNFIIAASTALEAFMSMEPSREARLTVTKAAEKGWKFATPDDDLL
IVDIVIVAYLPNEQDIIMDRINYACQKLEYPTDKIRINIVYNTPFPIQSLEEEMWEATAK
YPQLRIIKVEGSTSKADNLNYYLSLDTGSDVTAIYDCDHYIHPHSPRWAIERFIKEKGKV
DIVQGRCIVFNTGASFLTSLISIEFDKIYAVSHPGRATIWGFGLFTGSNGYWRTSLLRDV
KMDENMLTEDIDSALRTVGRGCNIVHDLNVVSYELAPTTFGAFWKQRLRWAQGWAQASLK
HSILTFNRAKEGKRIFTTRFGLLNLLLIRELSYYLVTQFACLVASFIFLNFPLTPAAFWK
TVFFQYPVSEWFFFVSIFCLIGTLWVTNQVKSEFASRWMIIKFSIAYPFYLLFLATIGLY
GHARQLTKYSSWNPTARS

Enzyme Prediction     

No EC number prediction in Bcin06g03790.1:RNA-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	273	467	7.1e-22	0.8121827411167513

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133045	CESA_like	7.70e-33	184	370	1	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
224136	BcsA	9.10e-31	119	533	1	392	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
133043	CESA_CelA_like	8.51e-21	182	416	3	232	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.
133049	CESA_like_2	2.03e-19	206	422	24	238	CESA_like_2 is a member of the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, Glucan Biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of glucan.
404513	Glyco_trans_2_3	2.65e-15	276	469	6	194	Glycosyl transferase family group 2. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATZ50909.1|GT2	0.0	1	558	1	558
CCD48160.1|GT2	0.0	1	558	1	558
APA08880.1|GT2	0.0	1	558	1	562
CBX90388.1|GT2	2.83e-226	90	558	32	505
CAE7201725.1|GT2	4.63e-226	55	558	1	509

PDB Hits     

Bcin06g03790.1:RNA-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q7XIF5|CSLA7_ORYSJ	9.90e-12	192	415	159	386	Probable glucomannan 4-beta-mannosyltransferase 7 OS=Oryza sativa subsp. japonica OX=39947 GN=CSLA7 PE=2 SV=1
sp|P96587|YDAM_BACSU	1.95e-10	182	436	51	301	Uncharacterized glycosyltransferase YdaM OS=Bacillus subtilis (strain 168) OX=224308 GN=ydaM PE=3 SV=1
sp|Q8GLC5|ICAA_STAEP	5.89e-10	192	420	57	277	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus epidermidis OX=1282 GN=icaA PE=3 SV=1
sp|Q5HKQ0|ICAA_STAEQ	1.04e-09	192	420	57	277	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) OX=176279 GN=icaA PE=1 SV=1
sp|Q8NUI7|ICAA_STAAW	7.52e-09	247	420	106	277	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain MW2) OX=196620 GN=icaA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000044	0.000001

TMHMM  Annotations     

Start	End
97	119
129	151
451	473
483	505
518	540