CAZyme Information: Bcin06g01630.1:RNA-p1

Basic Information

• Species: Botrytis cinerea
• Lineage: Ascomycota; Leotiomycetes; ; Sclerotiniaceae; Botrytis; Botrytis cinerea
• CAZyme ID: Bcin06g01630.1:RNA-p1
• CAZy Family: GH15
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
539		57814.56	5.9986

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_BcinereaB05-10	12073	332648	366	11707

• Gene Location: location=bcin_chr_6:586826-588661(-)

Full Sequence      

MARITGVVLLSLVQAIHAQSSFTVARTAPKNAGTPLPAFISYSIEFCFFPDYAGNNSSPN
TFSENLLNNLGNFQGTKPHIRVGGNTQDYALYNASLPYAVNGTIDPAKATDYPTTVYFGP
SFFESYNTWSDVKFSHGFNLGLGANNSAGWQTLLDTIPLACKALEGGKLLMWEYGNEPDL
FSTSAQGPVRPPTWNESTYVSQWLNGSRQIKEGVAAACPDLASYGFLAPSFAGVENHLDP
VTTWNDGLDVDKDIELISSHNYIGGATQPGVTLQGTLMNHTSTVVSVGRQLNVSNILSSS
DVPFILGETNSLYNEGAPGLSNAYGAALWNLDFALYGASTSIRRIHFHTGLSFRYGAWQP
QDTDVVPKGTKPPYYGNIAAAAFLSNLTAATTTIAEIPLSNELESAYAAYVNGALKRVII
INMHQYNYTVNGTSTVVNPVPRPIRNYTITIPTNSTTGSSGHHAPAALPKFATLRALHAN
GSDAITGITYDGYSYNYELDNGKPVRLHNVTVGHTVKVADGKFTVPVEDSGAVMVDFGA

Enzyme Prediction     

EC	3.2.1.31:3	3.2.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH79	38	513	2.7e-84	0.9472527472527472

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407104	Glyco_hydro_79C	1.40e-19	406	534	1	103	Glycosyl hydrolase family 79 C-terminal beta domain. This domain is found at the C-terminus of glycosyl hydrolase family 79 proteins. It's function is not yet known.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATZ50670.1|GH79	0.0	1	539	1	539
CCD49125.1|GH79	0.0	1	539	1	539
APA08818.1|GH79	0.0	1	539	1	539
QSZ32183.1|GH79	0.0	1	539	1	556
UKZ70809.1|GH79	1.28e-204	29	537	28	539

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7DFQ_A	1.00e-28	21	535	4	457	Chain A, 4-O-alpha-L-rhamnosyl-beta-D-glucuronidase [Fusarium oxysporum],7DFS_A Chain A, 4-O-alpha-L-rhamnosyl-beta-D-glucuronidase [Fusarium oxysporum]
5G0M_A	1.62e-20	25	381	9	358	beta-glucuronidase with an activity-based probe (N-acyl cyclophellitol aziridine) bound [Acidobacterium capsulatum],5G0Q_A beta-glucuronidase with an activity-based probe (N-alkyl cyclophellitol aziridine) bound [Acidobacterium capsulatum]
3VNY_A	1.74e-20	25	381	9	358	Crystal structure of beta-glucuronidase from Acidobacterium capsulatum [Acidobacterium capsulatum ATCC 51196],3VNZ_A Crystal structure of beta-glucuronidase from Acidobacterium capsulatum in complex with D-glucuronic acid [Acidobacterium capsulatum ATCC 51196],3VO0_A Crystal structure of beta-glucuronidase from Acidobacterium capsulatum covalent-bonded with 2-deoxy-2-fluoro-D-glucuronic acid [Acidobacterium capsulatum ATCC 51196]
5L77_A	4.30e-20	25	381	29	378	A glycoside hydrolase mutant with an unreacted activity based probe bound [Acidobacterium capsulatum]
5BWI_A	2.49e-18	20	422	11	365	Crystallographic structure of a bacterial heparanase [Burkholderia pseudomallei],5BWI_B Crystallographic structure of a bacterial heparanase [Burkholderia pseudomallei]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q7SFB0|GUS79_NEUCR	2.20e-202	1	511	1	522	Beta-glucuronidase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=NCU00937 PE=1 SV=1
sp|A2QEQ6|GUS79_ASPNC	7.14e-184	17	520	30	523	Beta-glucuronidase OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=An02g11890 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000280	0.999694	CS pos: 18-19. Pr: 0.9800

TMHMM  Annotations     

There is no transmembrane helices in Bcin06g01630.1:RNA-p1.