CAZyme Information: Bcin06g01510.1:RNA-p1

Basic Information

• Species: Botrytis cinerea
• Lineage: Ascomycota; Leotiomycetes; ; Sclerotiniaceae; Botrytis; Botrytis cinerea
• CAZyme ID: Bcin06g01510.1:RNA-p1
• CAZy Family: GH13|GH13
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
404		47398.84	7.1590

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_BcinereaB05-10	12073	332648	366	11707

• Gene Location: location=bcin_chr_6:539753-541176(-)

Full Sequence      

MAIQLSKPRYFLQNQTTRIFKILSVFVLFYICTYLLLPRIQSSPLTITEEDISFEQRTSH
ISNNFLPASSADQLCASHSLTPYPHRSQKRKIYDLFMVNSELDWLEIRLNEMNTEVDYFV
ILEAPTTFTGLAKNMTFQENRAKFSAFEDKIIYHVLTDAPPPVANTTLPGSKEYEANAWI
QEKFQRDAMFTQVFPKLEHEQKPIEGDVILVSDIDEVIRPATLQVLRNCNFPLILTLRSQ
FYYYSFQFRHRGEQWAHPQATFYQGLENTIKPHSLRSRHGGHVHVDERDSKVVGNLWNAA
WHCSSCFSTLKEMRRKMESFSHTNLNKQEFRMTDRIVDRVGKGKDLWDRFGQWYKRVDNN
NDIPSYIKDHRSKFGYMVDRDGEGAGFVDYEEIIEKEKKGMDLI

Enzyme Prediction     

No EC number prediction in Bcin06g01510.1:RNA-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT17	70	378	4.8e-81	0.9894366197183099

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
398414	Glyco_transf_17	2.14e-51	70	377	56	341	Glycosyltransferase family 17. This family represents beta-1,4-mannosyl-glycoprotein beta-1,4-N-acetylglucosaminyltransferase (EC:2.4.1.144). This enzyme transfers the bisecting GlcNAc to the core mannose of complex N-glycans. The addition of this residue is regulated during development and has functional consequences for receptor signalling, cell adhesion, and tumor progression.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCD49147.1|GT17	1.53e-305	1	404	1	404
ATZ50658.1|GT17	1.53e-305	1	404	1	404
APA08827.1|GT17	1.55e-257	1	404	1	404
QSZ32189.1|GT17	1.75e-247	1	404	1	404
QSZ33799.1|GT17	4.35e-107	74	391	53	351

PDB Hits     

Bcin06g01510.1:RNA-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q09327|MGAT3_HUMAN	5.93e-06	86	379	202	499	Beta-1,4-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase OS=Homo sapiens OX=9606 GN=MGAT3 PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000022	0.000002

TMHMM  Annotations     

Start	End
20	37