CAZyme Information: Bcin06g00490.1:RNA-p1

Basic Information

• Species: Botrytis cinerea
• Lineage: Ascomycota; Leotiomycetes; ; Sclerotiniaceae; Botrytis; Botrytis cinerea
• CAZyme ID: Bcin06g00490.1:RNA-p1
• CAZy Family: GH132
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
398	bcin_chr_6|CGC13	41428.75	4.0846

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_BcinereaB05-10	12073	332648	366	11707

• Gene Location: location=bcin_chr_6:220812-222165(-)

Full Sequence      

MIAQIRNTAALVALTSAASVLARPHFSTRATQASTDLCGDYDYLILNNSPWIVYNMLYNA
KQIVGSQCTYYDSMITGSDGTAEVKWNSETDITYVESTNNVPKGYSFVGLTQNLETPLTG
IASIPTTYTWTRSNTTAFKGNVCYDFMTNDVKGDSTSSSSQELMLWLQYEGGQLPIGWAD
GSVATIDNLFGTSWDLYQGLNTDSGITVSSMLPRTQFEGTFEGDLREWLVALVGQGVFTE
STYVNVGNAGTEFFYGNAIMNATLGLQIDLGTATSAAVKVAAVSSVSSSASQIASTSSIV
EVPSSSVAAATPSVTQSSTEAPTSTAFVASVSASAKSSTKSHHVATPSAPVVKESTIASG
AKSTGMAASSAAGIETSVSSAAIAAPTSTGEGDDDCEV

Enzyme Prediction     

No EC number prediction in Bcin06g00490.1:RNA-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH12	116	258	1.2e-26	0.8910256410256411

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396303	Glyco_hydro_12	7.66e-13	50	258	2	194	Glycosyl hydrolase family 12.
235746	PRK06215	2.78e-06	9	204	15	174	hypothetical protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATZ50552.1|GH12	3.64e-269	1	398	1	398
CCD49289.1|GH12	3.91e-241	1	398	1	398
APA15870.1|GH12	1.67e-170	1	272	1	272
QSZ32436.1|GH12	9.05e-161	1	272	1	272
QMW39227.1|GH12	2.52e-137	10	270	7	266

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3VL8_A	2.04e-17	32	257	9	215	Crystal structure of XEG [Aspergillus aculeatus],3VL9_A Crystal structure of xeg-xyloglucan [Aspergillus aculeatus],3VL9_B Crystal structure of xeg-xyloglucan [Aspergillus aculeatus]
3VLB_B	4.56e-17	35	257	5	208	Crystal structure of xeg-edgp [Aspergillus aculeatus],3VLB_D Crystal structure of xeg-edgp [Aspergillus aculeatus]
6K9D_A	2.01e-16	43	256	7	203	Chain A, GH12 beta-1, 4-endoglucanase [Aspergillus fischeri]
6K98_A	3.33e-15	43	256	8	204	Chain A, GH12 beta-1, 4-endoglucanase [Aspergillus fischeri]
5GM3_A	1.82e-13	43	256	7	204	Crystal structure of FI-CMCase from Aspergillus aculeatus F-50 [Aspergillus aculeatus],5GM3_B Crystal structure of FI-CMCase from Aspergillus aculeatus F-50 [Aspergillus aculeatus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1XP58|XGEA_ASPNG	1.31e-19	10	257	8	227	Xyloglucan-specific endo-beta-1,4-glucanase A OS=Aspergillus niger OX=5061 GN=xgeA PE=1 SV=1
sp|A2Q877|XGEA_ASPNC	3.38e-19	10	257	8	227	Probable xyloglucan-specific endo-beta-1,4-glucanase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=xgeA PE=3 SV=1
sp|Q5BG78|XGEA_EMENI	7.55e-18	11	257	8	225	Xyloglucan-specific endo-beta-1,4-glucanase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=xgeA PE=1 SV=1
sp|O94218|XGEA_ASPAC	4.84e-17	27	257	13	224	Xyloglucan-specific endo-beta-1,4-glucanase A OS=Aspergillus aculeatus OX=5053 GN=xgeA PE=1 SV=1
sp|G4ZHR2|XEG1_PHYSP	9.86e-15	27	263	12	234	Xyloglucan-specific endo-beta-1,4-glucanase 1 OS=Phytophthora sojae (strain P6497) OX=1094619 GN=XEG1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000437	0.999549	CS pos: 29-30. Pr: 0.7911

TMHMM  Annotations     

There is no transmembrane helices in Bcin06g00490.1:RNA-p1.