CAZyme Information: Bcin05g07270.1:RNA-p1

Basic Information

• Species: Botrytis cinerea
• Lineage: Ascomycota; Leotiomycetes; ; Sclerotiniaceae; Botrytis; Botrytis cinerea
• CAZyme ID: Bcin05g07270.1:RNA-p1
• CAZy Family: GH13
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
888	bcin_chr_5|CGC1	97610.95	4.8822

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_BcinereaB05-10	12073	332648	366	11707

• Gene Location: location=bcin_chr_5:2563471-2566624(-)

Full Sequence      

MSESPDSQISDPIFDRFEEGSDILSSRDTIATPNSEMTPPESPVEKHAILDPRTKSRQLA
ASLSLEEQVSLLVAADFWRSKSIPSKGVPAFKTSDGPNGARGAIFKAGTKAALFPCGISL
AATWNTDLIHEVGQHLADETKARSAQVLLAPTVCLHRGPLGGRNFESFSEDPYLTGKLAI
AYIKGLQEKGIAATIKHFVANEQETFRLTIDSVVQERPLRELYLRPFEMAIREANPWAVM
SSYNLINGVHADCNFHTLREILREEWSYDGLVMSDWGGTNSIVESIEAGCDIEMPVSTKW
RGAKAIEAVKNGELSREAVEKAAANVLYLVERTKGSDMTPEAPEAEDDREETRKLIRRAG
VEGLTLLKNKDNILPIKSSQTKVAVIGPNANRAIAGGGGSASLNPYYNTIPLDSIKAIPG
IDVTYALGCHTYKWLPLAADYCTTSTGAQGVTLEFHIGDKFEGAPRIIQHRTNTDLFLWD
SVPEEVNPIWSVRAKTILTPTTTGLHTLSFSSVGPGRLLVNGDVKVDLWNWTDLGEAMFS
GSKDILFDIFLEANVPVQLVAETTNEIRPLSKQAQVNQTHATGGCRIGYKEADAENYLQK
AIDAAKSSDVAIVIVGLDAEWESEGYDRQTMDLPSDGSQDRLIDAIVDANPNTIVVNQSG
SPVTMPWAKKVPAILQAWYQGQEAGNALADVLFGFENPSGKLPTTFPVRLSDNPTYHTWP
GENLRSLYGEGLYIGYRHYDHLSLPPLFPFGHGLSYTTFSYSAPTLSSQTFSSSNQDRIT
LSLNIKNTGPRKGKEIVQLYIHDVKSSLVRPEKELKGFAKVELEAGEEKSVDIVIDKYAL
GYWDESLRNGKGLWIAEEGEFEAWVGASAEDIRQKTSFEVKESFTWIF

Enzyme Prediction     

EC	3.2.1.21:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	82	295	2.5e-67	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	1.10e-95	114	879	120	763	beta-glucosidase BglX.
224389	BglX	1.17e-66	76	401	48	373	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
396478	Glyco_hydro_3_C	7.78e-62	364	736	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
178629	PLN03080	6.07e-53	54	836	51	743	Probable beta-xylosidase; Provisional
395747	Glyco_hydro_3	1.88e-46	87	329	65	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATZ50372.1|GH3	0.0	1	888	1	888
APA09558.1|GH3	0.0	1	888	1	887
QSZ37473.1|GH3	0.0	1	873	1	874
VBB72333.1|GH3	0.0	24	888	28	908
AEO66128.1|GH3	0.0	20	888	24	888

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	1.09e-185	58	886	8	842	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	9.15e-181	58	886	8	842	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	3.93e-155	57	883	6	671	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	1.28e-124	63	872	12	655	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	4.03e-113	55	882	3	715	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5BFG8|BGLB_EMENI	4.44e-218	61	875	16	833	Beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglB PE=1 SV=1
sp|Q2U8Y5|BGLI_ASPOR	1.32e-212	52	887	2	837	Probable beta-glucosidase I OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglI PE=3 SV=1
sp|B8NDE2|BGLI_ASPFN	2.95e-211	52	887	2	837	Probable beta-glucosidase I OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=bglI PE=3 SV=2
sp|Q0CAF5|BGLI_ASPTN	3.72e-209	63	887	13	837	Probable beta-glucosidase I OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=bglI PE=3 SV=1
sp|A1CA51|BGLI_ASPCL	2.02e-208	63	887	13	836	Probable beta-glucosidase I OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000068	0.000000

TMHMM  Annotations     

There is no transmembrane helices in Bcin05g07270.1:RNA-p1.