CAZyme Information: Bcin05g06020.1:RNA-p1

Basic Information

• Species: Botrytis cinerea
• Lineage: Ascomycota; Leotiomycetes; ; Sclerotiniaceae; Botrytis; Botrytis cinerea
• CAZyme ID: Bcin05g06020.1:RNA-p1
• CAZy Family: GH125
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
487		51274.38	4.7452

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_BcinereaB05-10	12073	332648	366	11707

• Gene Location: location=bcin_chr_5:2069866-2071449(+)

Full Sequence      

MHISNLITLAILPLAYGQLDTLAKAAGLKYFGSATDNGELTDTQYTAILSNNSQFGQITP
GNTQKWQYIEPTQNTFSYTKGDVVVDFAEKNDQILRCHNLCWYNQLPSWVTSGTWTNETL
IAVLKNHIKNEVTYYKGKCYAWDVVNEAFNDDGTWRSFVFYDTIGPEYIPIAFETAALYD
PDVKLYYNDYNIESSGAKATATLNLVKSLQARGIKIDGVGLQAHFIVGSTPSESALATTL
KSFTALNVEVAYTELDVRFSSLPPTTAGLAQQGVDYANTVNACLSVDGCVGITIWDFTDA
YSWIPSTFSGQGDACLWYANYTVHPAYNNVVAALAAAAGTVAPVTSTIVSATSTAKVSES
SAVSTSPSAPAVLISSSVSVSAVVPSVSSVVQVASSSVLSSAAVSSAVSVPISSSPIPSS
STLKKCTKTLSSTTITKTTSTAAASGTGAAVALYGQCGGVNYKGSTVCAAGATCTAQNDY
YSQCIPA

Enzyme Prediction     

EC	3.2.1.8:31

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH10	20	332	4.1e-96	0.9867986798679867

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395262	Glyco_hydro_10	7.67e-139	19	328	1	306	Glycosyl hydrolase family 10.
214750	Glyco_10	9.50e-114	65	328	2	261	Glycosyl hydrolase family 10.
226217	XynA	5.08e-76	22	327	35	334	Endo-1,4-beta-xylanase, GH35 family [Carbohydrate transport and metabolism].
395595	CBM_1	3.64e-12	453	481	1	29	Fungal cellulose binding domain.
197593	fCBD	1.20e-11	452	485	1	34	Fungal-type cellulose-binding domain. Small four-cysteine cellulose-binding domain of fungi

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATZ50233.1|CBM1|GH10	1.50e-290	1	487	1	487
CCD53493.2|CBM1|GH10	4.79e-280	1	487	1	487
APA09395.1|CBM1|GH10	4.67e-246	1	485	1	403
QSZ37437.1|CBM1|GH10	5.38e-220	1	485	1	454
QZJ84314.1|CBM1|GH10	3.32e-166	18	343	20	345

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6JDT_A	3.11e-152	19	336	3	319	Crystal structure of GH10 family xylanase XynAF1 from Aspergillus fumigatus Z5 [Aspergillus fumigatus Z5],6JDT_B Crystal structure of GH10 family xylanase XynAF1 from Aspergillus fumigatus Z5 [Aspergillus fumigatus Z5],6JDY_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 120 minutes [Aspergillus fumigatus Z5],6JDY_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 120 minutes [Aspergillus fumigatus Z5],6JDZ_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 20 minutes [Aspergillus fumigatus Z5],6JDZ_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 20 minutes [Aspergillus fumigatus Z5],6JE0_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 30 minutes [Aspergillus fumigatus Z5],6JE0_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 30 minutes [Aspergillus fumigatus Z5],6JE1_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 40 minutes [Aspergillus fumigatus Z5],6JE1_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 40 minutes [Aspergillus fumigatus Z5],6JE2_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 80 minutes [Aspergillus fumigatus Z5],6JE2_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 80 minutes [Aspergillus fumigatus Z5]
6Q8M_A	7.19e-140	19	485	25	406	GH10 endo-xylanase [Aspergillus aculeatus ATCC 16872],6Q8M_B GH10 endo-xylanase [Aspergillus aculeatus ATCC 16872],6Q8N_A GH10 endo-xylanase in complex with xylobiose epoxide inhibitor [Aspergillus aculeatus ATCC 16872],6Q8N_B GH10 endo-xylanase in complex with xylobiose epoxide inhibitor [Aspergillus aculeatus ATCC 16872]
3WUF_A	7.16e-108	19	334	5	312	The mutant crystal structure of b-1,4-Xylanase (XynAS9_V43P/G44E) from Streptomyces sp. 9 [Streptomyces sp.],3WUG_A The mutant crystal structure of b-1,4-Xylanase (XynAS9_V43P/G44E) with xylobiose from Streptomyces sp. 9 [Streptomyces sp.]
3WUB_A	1.01e-107	19	334	5	312	The wild type crystal structure of b-1,4-Xylanase (XynAS9) from Streptomyces sp. 9 [Streptomyces sp.],3WUE_A The wild type crystal structure of b-1,4-Xylanase (XynAS9) with xylobiose from Streptomyces sp. 9 [Streptomyces sp.]
4F8X_A	1.97e-99	18	334	3	327	Penicillium canescens endo-1,4-beta-xylanase XylE [Penicillium canescens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5ZNB1|XYND_TALFU	2.85e-136	4	340	6	340	Endo-1,4-beta-xylanase D OS=Talaromyces funiculosus OX=28572 GN=xynD PE=1 SV=1
sp|Q9HEZ1|XYNA_PHACH	6.77e-127	18	330	93	402	Endo-1,4-beta-xylanase A OS=Phanerodontia chrysosporium OX=2822231 GN=xynA PE=1 SV=1
sp|B7SIW2|XYNC_PHACH	1.01e-126	13	336	78	399	Endo-1,4-beta-xylanase C OS=Phanerodontia chrysosporium OX=2822231 GN=xynC PE=1 SV=1
sp|P79046|XYN1_HUMGT	5.09e-121	1	335	1	338	Endo-1,4-beta-xylanase 1 OS=Humicola grisea var. thermoidea OX=5528 GN=xyn1 PE=2 SV=1
sp|O60206|XLNA_AGABI	8.40e-114	1	331	1	328	Endo-1,4-beta-xylanase OS=Agaricus bisporus OX=5341 GN=xlnA PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000258	0.999728	CS pos: 25-26. Pr: 0.7016

TMHMM  Annotations     

There is no transmembrane helices in Bcin05g06020.1:RNA-p1.