CAZyme Information: Bcin05g01660.1:RNA-p1

Basic Information

• Species: Botrytis cinerea
• Lineage: Ascomycota; Leotiomycetes; ; Sclerotiniaceae; Botrytis; Botrytis cinerea
• CAZyme ID: Bcin05g01660.1:RNA-p1
• CAZy Family: GH105
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
415		45358.39	4.3003

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_BcinereaB05-10	12073	332648	366	11707

• Gene Location: location=bcin_chr_5:637943-639502(-)

Full Sequence      

MYFTNTVGTLLAATLVASKPIYQRGVDFAYGSTPVRGVNIGGWLVLEPWITPSIFQGVDQ
SLGIVDEYTLTQKLGEEAALAILKPHWDSWCTADDFQNIANAGFNTVRIPIGYWAYGLSD
NEPYTQGAAAYMDAAIDWARGAGLKVWIDLHGAPLSQNGFDNSGHKTSSPAFGQGDSVKN
TLSVLNTITEKYAKKEYQDVVVGIELLNEPANWKVNFDVLEQFYRDGYGQVRAVSDSIVV
IHDAFLAPSNWNNILSSNDANAYGVVVDHHEYQVFSDSLVAMSAAEHVEYVCSNAGAYTG
ADKWVVVGEFTAAMTDCAYALNGYGVGARYDGTYPGSSYVGSCEGKSDITTWSDDFKTDM
KNYLSAQLSSYETKANGWIFWNFKTEGAHEWDAAKLVEYDIFPDLRAGTPAAICS

Enzyme Prediction     

EC	3.2.1.58:29	3.2.1.21:6	3.2.1.75:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	86	386	4.4e-114	0.9933993399339934

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225344	BglC	2.29e-59	35	403	18	382	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
395098	Cellulase	7.52e-11	88	210	22	131	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATZ49756.1|GH5_9	0.0	1	415	1	415
CCD33819.1|GH5_9	0.0	1	415	1	415
QFF92519.1|GH5_9	1.72e-303	1	415	1	415
QFF92520.1|GH5_9	8.17e-302	1	415	1	415
APA09967.1|GH5_9	3.43e-264	1	415	1	414

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2PB1_A	1.59e-131	24	403	4	385	Exo-B-(1,3)-Glucanase from Candida Albicans in complex with unhydrolysed and covalently linked 2,4-dinitrophenyl-2-deoxy-2-fluoro-B-D-glucopyranoside at 1.9 A [Candida albicans]
1CZ1_A	3.71e-131	30	403	4	379	Exo-b-(1,3)-glucanase From Candida Albicans At 1.85 A Resolution [Candida albicans],1EQC_A Exo-b-(1,3)-glucanase From Candida Albicans In Complex With Castanospermine At 1.85 A [Candida albicans]
2PC8_A	4.53e-131	24	403	4	385	Chain A, Hypothetical protein XOG1 [Candida albicans]
2PBO_A	4.53e-131	24	403	4	385	Chain A, Hypothetical protein XOG1 [Candida albicans]
4M80_A	8.80e-131	24	403	3	384	The structure of E292S glycosynthase variant of exo-1,3-beta-glucanase from Candida albicans at 1.85A resolution [Candida albicans SC5314],4M81_A The structure of E292S glycosynthase variant of exo-1,3-beta-glucanase from Candida albicans complexed with 1-fluoro-alpha-D-glucopyranoside (donor) and p-nitrophenyl beta-D-glucopyranoside (acceptor) at 1.86A resolution [Candida albicans SC5314],4M82_A The structure of E292S glycosynthase variant of exo-1,3-beta-glucanase from Candida albicans complexed with p-nitrophenyl-gentiobioside (product) at 1.6A resolution [Candida albicans SC5314]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P29717|EXG1_CANAL	1.16e-129	22	403	36	423	Glucan 1,3-beta-glucosidase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=XOG1 PE=1 SV=5
sp|Q96V64|EXG_BLUGR	2.22e-129	13	403	15	404	Glucan 1,3-beta-glucosidase OS=Blumeria graminis OX=34373 PE=3 SV=1
sp|Q8NKF9|EXG_CANOL	4.18e-124	10	403	10	411	Glucan 1,3-beta-glucosidase OS=Candida oleophila OX=45573 GN=EXG1 PE=3 SV=1
sp|O93983|EXG2_WICAO	2.54e-123	4	403	5	414	Glucan 1,3-beta-glucosidase 2 OS=Wickerhamomyces anomalus OX=4927 GN=EXG2 PE=3 SV=1
sp|Q12628|EXG_KLULA	1.76e-121	1	403	4	413	Glucan 1,3-beta-glucosidase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) OX=284590 GN=KLLA0C05324g PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.706873	0.293122

TMHMM  Annotations     

There is no transmembrane helices in Bcin05g01660.1:RNA-p1.